CAZyme Information: MGYG000001084_00139

Basic Information

• Species: Collinsella sp900555955
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900555955
• CAZyme ID: MGYG000001084_00139
• CAZy Family: GH25
• CAZyme Description: Toxin A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42505.5	9.7392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001084	2045378	MAG	Sweden	Europe

• Gene Location: Start: 2113; End: 3234 Strand: -

Full Sequence      

MQYTAFPTNDRGWQYTSSGQISGITGNVDLNAFGYRTPTTRYREVLIDGKWYYIDATTGK
KVTGWQWLSSSGGKWVYYDPTDGHMLYGEQKIAGKWYYLDPGTGARVTGWTYLKGDVNKW
TYYGQDGAMLYGEQKIAGKWYYLNPVSGARMTGWVVLPDGRNVYYSPYMVYGEQKINGAW
YYLDPVTGARKQGWQRLKSNGGKTVYYGSDGKMAYGEQTIDGKQYYLKLGTGARFAGWRR
VVTTRDHRGDKWVYYGSDGAMLHGEGKVSGYWYFFDDGTSKSNGRVTYGWKNLGSKIVYY
SWPEGKMQYGEQKIGGAWYYLNPVTGARKTGWQYLNSNGGKTVYYGSDGKMVYGTQYIDG
QKYYFDPVTGAKR

Enzyme Prediction     

No EC number prediction in MGYG000001084_00139.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	4.13e-27	63	322	443	637	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	4.17e-25	63	274	486	658	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG5263	COG5263	3.33e-24	47	366	43	309	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033930	pneumo_PspA	1.58e-22	108	345	443	614	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
COG5263	COG5263	2.24e-21	45	226	155	307	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOL46485.1	7.58e-116	1	348	399	746
BCB69521.1	1.53e-115	1	348	428	775
QOL42365.1	1.17e-114	1	348	399	746
BAJ67471.1	2.10e-50	1	213	423	635
VEG80342.1	2.10e-50	1	213	423	635

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001084_00139.