CAZyme Information: MGYG000001084_01063

Basic Information

• Species: Collinsella sp900555955
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900555955
• CAZyme ID: MGYG000001084_01063
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275		29878.28	4.0936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001084	2045378	MAG	Sweden	Europe

• Gene Location: Start: 22; End: 849 Strand: +

Full Sequence      

MSTPERFGFMWECPGYLELEADGGVPAKWLSFSPQGLEGGRWDRGNVYAAGYMPVTGDIT
GVDGTYELGDFRLWDAGFDFYAPQEFTAEDGRHILIGWMGMPDEPTYGNAPTVVCGWQHC
MTVPRELTAGDGGVVLQQPAREIERHYASVRVGAGSLEVAGDTCFDVVVDGVDGAFTATV
DGELRLSFMPAEGELPARFEMRFTDESRASAGCGRTVRWEPVDEVRNVRIVGDASSVEVF
VNDGALVFSTRIYPDTYGVTVDAPGASVNYHALSI

Enzyme Prediction     

No EC number prediction in MGYG000001084_01063.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	6	139	1.1e-26	0.40273037542662116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	4.84e-52	7	255	202	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd18623	GH32_ScrB-like	2.80e-50	3	128	171	286	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
COG1621	SacC	8.02e-49	5	270	212	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	2.95e-35	6	139	182	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	3.85e-32	2	244	182	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33159.1	2.00e-188	1	275	239	513
SDR64968.1	3.09e-100	1	275	216	483
ADK67558.1	1.27e-87	1	268	212	475
AEB06470.1	7.65e-85	1	273	235	527
AKT49546.1	4.65e-76	1	275	212	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PIG_A	1.55e-20	4	253	227	485	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
6NUM_A	7.93e-19	4	253	227	485	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
7VCO_A	1.73e-16	9	254	213	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	3.82e-14	8	255	230	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.82e-14	8	255	230	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.34e-35	5	267	213	469	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	9.71e-31	5	255	216	465	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P27217	1.41e-25	8	254	214	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P16553	5.35e-25	9	254	211	449	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
Q56660	2.64e-24	6	269	277	527	Probable sucrose-6-phosphate hydrolase OS=Vibrio cholerae OX=666 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001084_01063.