CAZyme Information: MGYG000001085_00080

Basic Information

• Species: RC9 sp000434935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000434935
• CAZyme ID: MGYG000001085_00080
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	MGYG000001085_2|CGC1	39369.31	5.2853

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001085	2352626	MAG	Sweden	Europe

• Gene Location: Start: 47737; End: 48783 Strand: +

Full Sequence      

MKIHRRLKIVLKYMVPSVIVMVGIPLLQKTVIDGDPFEKDELRCVISTDGKSPMNYAVGF
EYEMLTLFAWQMGKTVDISLGGPEYLDSLATGNVDILVMPYADSLVYDQDYYASVPLADS
CSWVIDGKLRVEHKEINLWLARFSISEQQKTIVGRFTPAYEPYGRARSGRTYKTLSPYDD
LIKKYASVLGWDRSMLTALIWQESQFHIEAHSKRGAVGLMQMMPRTAGRFAADDMLDPEG
NIRAAVKYLRLLQNMFRGYAADDEELTKFTLAAYNAGEGRIMDCINYAASINAPHGRWED
IVAIIPDMREDSILEEDTVKLGKFLGYETINYVSKLESLSRTFAGLLN

Enzyme Prediction     

No EC number prediction in MGYG000001085_00080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	194	336	3.7e-23	0.7407407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	3.68e-46	182	335	1	151	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	2.80e-27	177	281	3	109	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	9.50e-26	193	280	1	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.79e-25	177	280	5	110	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.75e-23	182	288	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRY96252.1	8.91e-118	1	296	1	297
AGY53417.1	3.48e-39	38	336	37	340
QZT36545.1	4.31e-34	62	347	177	475
AKP50690.1	8.44e-31	84	348	200	465
QEO74668.1	9.65e-31	175	336	13	174

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.62e-09	178	293	453	572	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	2.88e-09	178	293	453	572	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5MPQ_A	6.54e-09	171	280	409	517	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.56e-09	171	280	413	521	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.60e-09	171	280	419	527	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	9.81e-20	84	336	183	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q9CPJ2	2.71e-16	36	336	142	443	Membrane-bound lytic murein transglycosylase F OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltF PE=3 SV=2
A0KJ50	6.63e-16	170	348	285	458	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
A5F353	7.44e-15	175	347	298	465	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=mltF PE=3 SV=1
Q9KTN5	7.44e-15	175	347	298	465	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999548	0.000455	0.000003	0.000001	0.000001	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001085_00080.