CAZyme Information: MGYG000001087_00114

Basic Information

• Species: Anaerostipes sp900756035
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes; Anaerostipes sp900756035
• CAZyme ID: MGYG000001087_00114
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262	MGYG000001087_21|CGC1	29706.46	8.4963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001087	3616712	MAG	Sweden	Europe

• Gene Location: Start: 23; End: 811 Strand: +

Full Sequence      

MNDEGLRVTGWQTIAGKKYYFMPDGTRYGNGWLSFGSTYYYMMPDGHMHTGWLSFGSTYY
YLNSNGVRVTGWQTIDGEEYYFDKNGVRQEGYLIEGTSAVTANNLAMYFKRKNGVYPTFY
KNSDAPTIEKFCQIYVEESKAEGIKVEVAFMQAMVETGWLKFGGAVQISQYNFAGIGALD
GGAQGATFKTIREGVRAQIQHLKAYANEKPLNNTQVDPRFQLVKRGSAKYVEWLGQKENP
NGYGWATAEDYGYKILRLIKEL

Enzyme Prediction     

No EC number prediction in MGYG000001087_00114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	132	261	2.3e-22	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033840	PspC_relate_1	5.93e-20	9	114	510	606	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033838	PspC_subgroup_1	1.14e-18	1	179	518	665	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	1.81e-17	2	118	499	606	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	2.85e-17	9	118	486	586	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	8.00e-17	1	92	495	585	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL25595.1	9.10e-61	92	262	87	258
CBL26238.1	5.73e-60	92	262	82	253
QWT54385.1	7.62e-59	92	256	438	601
QRT51288.1	1.73e-58	92	259	81	249
AEN97541.1	3.14e-58	94	262	1616	1783

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	4.19e-27	124	262	64	195	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999799	0.000232	0.000008	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001087_00114.