CAZyme Information: MGYG000001088_00138

Basic Information

• Species: Haemophilus_D parainfluenzae_L
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_L
• CAZyme ID: MGYG000001088_00138
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001088_7|CGC1	38141.69	6.5025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001088	1866538	MAG	Sweden	Europe

• Gene Location: Start: 3293; End: 4267 Strand: -

Full Sequence      

MSKKRVGLSMVRNESDVIETFIRHNLTLLDELHIVDHNSSDNTREILTHLKQEGLPIHIY
HYNELEFAPERVLNHMMQHILNNDADIDYIFPLDADEFIYCPSREKLNTFLTLIPQDRVG
MYTWRGYLPHSTEYDPNFIFHFTDQRKEEILTPKVIIPRAIAETCTLTIGSHSVRDKEGK
EIQSIVFIGSNSQPFYYWFINRFNAKFIETDDLWLGHYPIRSTVQQIKKVLEKSITMVME
KKGYRDSAWENQLRDLLTHNLDISLDELRLIAYNYRASDEKQIQIACQQPLRSTKLALKY
QHLINNDPLPVLAKLILDLAEKLR

Enzyme Prediction     

No EC number prediction in MGYG000001088_00138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	110	1.2e-19	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13704	Glyco_tranf_2_4	3.90e-15	12	105	1	90	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
cd02511	Beta4Glucosyltransferase	2.94e-06	10	99	7	84	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	4.39e-06	11	99	6	91	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06423	CESA_like	1.47e-05	12	96	6	88	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd00761	Glyco_tranf_GTA_type	2.15e-05	11	149	5	139	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXW94324.1	3.07e-113	1	320	1	323
QXW90386.1	3.07e-113	1	320	1	323
VEB21889.1	3.23e-57	4	309	2	320
ACF12210.1	6.25e-27	10	283	1	253
AWX32218.1	6.95e-26	4	280	2	259

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001088_00138.