CAZyme Information: MGYG000001088_00211

Basic Information

• Species: Haemophilus_D parainfluenzae_L
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_L
• CAZyme ID: MGYG000001088_00211
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		43869.36	7.1397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001088	1866538	MAG	Sweden	Europe

• Gene Location: Start: 84284; End: 85453 Strand: +

Full Sequence      

MIKENPTIAIIAGEVSGDILGAGLIQALKRHYPQAKFVGIGGERMIVQGFESFFDMEELS
VMGLVEVLKHLPRLLKIRRSIIDQLSDIKPDVFIGIDAPDFNLTVELKLKEKGIKTIHYV
SPSVWAWRQNRIYKIAKATHQVLAFLPFEKAFYDRFNVPCRFIGHTMADAIPLKPNRTEA
CQTLGIDEKGRYLAILVGSRGSEVGFLTEPFLKTALLLKEKYPDLQFLVPLVNEKRRQQF
EEIKAQIAPDLDMHLIDGKARQVMIAAEATLLASGTAALEAMLCKSPMVVGYRMKPFTYF
LAKRLVKTKYISLPNLLADEMLVPEMIQEDCEPQKLAEQLSQYLGDDESAVKSRSVLIQR
FTELHKLIQCDADSQAAQAVIDLLEQKHD

Enzyme Prediction     

No EC number prediction in MGYG000001088_00211.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	369	3.9e-139	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	383	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	386	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	5	387	1	378	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	1.14e-178	8	380	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	4.29e-46	5	340	226	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR16198.1	1.90e-277	1	389	1	389
QOR25549.1	2.58e-275	1	389	1	389
VEI30784.1	7.40e-275	1	389	1	389
QOR20127.1	1.05e-274	1	389	1	389
QOR10737.1	1.49e-274	1	389	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	9.03e-164	1	385	1	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.82e-163	1	385	1	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45011	2.37e-224	1	387	1	387	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lpxB PE=3 SV=2
A5UD44	3.36e-224	1	385	1	385	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=lpxB PE=3 SV=1
Q4QLM6	3.91e-223	1	385	1	385	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=lpxB PE=3 SV=1
A5UII8	1.12e-222	1	387	1	387	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=lpxB PE=3 SV=1
Q65VI1	2.93e-215	1	387	8	394	Lipid-A-disaccharide synthase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001088_00211.