CAZyme Information: MGYG000001088_00693

Basic Information

• Species: Haemophilus_D parainfluenzae_L
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_L
• CAZyme ID: MGYG000001088_00693
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000001088_11|CGC3	37929.51	7.4623

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001088	1866538	MAG	Sweden	Europe

• Gene Location: Start: 131602; End: 132573 Strand: -

Full Sequence      

MRFSVIVPAYNVQDYIVSCIDSILKQSFRDYEIILVNDGSTDATFEHCQELCKKNTCIKL
VNKENGGLSSARNVGINQAEGDYLLFLDGDDFWRDDDFLENLNCIIETNSPDTIIFPYSY
YYGKDRIKEYEFDLSEVSSSSNKFSDDLYLLIDNGIWYPSACNKCIRRDIVAINNISFPL
NMTSEDVKWCFELSQHIASYYIYNKGVYMYRQNREGSISYKLKMKNLEDLFLNIENVLSG
SKKIRDADYLYLSHYYLEVIPYVMPFLKNPNVKRMLSKYKWLSKYSKNTRNIKKRIIYFC
LTYMGFRLSSLLLSILVKLYKST

Enzyme Prediction     

No EC number prediction in MGYG000001088_00693.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	170	2.5e-33	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	9.69e-27	5	87	1	84	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	3.73e-26	4	87	1	85	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	1.24e-20	2	87	1	88	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG0463	WcaA	1.97e-20	1	304	3	286	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
PRK10073	PRK10073	1.14e-19	2	86	7	91	putative glycosyl transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBW14385.1	9.81e-233	1	323	1	323
SQH96902.1	5.08e-126	1	322	1	322
QIM62299.1	3.19e-100	1	321	1	322
AGM38714.1	1.04e-94	1	321	1	327
SQI47916.1	6.11e-73	1	321	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.02e-27	4	216	8	221	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
5TZE_C	4.30e-18	1	216	1	208	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	9.08e-18	1	216	1	208	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
3BCV_A	7.29e-17	2	103	6	107	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
3L7M_A	9.20e-15	2	193	3	185	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH7	1.82e-23	2	102	6	105	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P71059	6.32e-23	4	213	6	214	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
A0A0H2UR96	7.87e-21	4	247	6	245	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71057	2.66e-20	4	188	7	186	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
P46918	4.92e-20	3	217	10	219	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
295	317