CAZyme Information: MGYG000001088_00807

Basic Information

• Species: Haemophilus_D parainfluenzae_L
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_L
• CAZyme ID: MGYG000001088_00807
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000001088_11|CGC7	38863.33	7.9187

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001088	1866538	MAG	Sweden	Europe

• Gene Location: Start: 259073; End: 260116 Strand: -

Full Sequence      

MNILIIGPSWVGDMMMSHSLYQQLKLQYPNCQIDVMAPNWCKPLLARMPEVCHAIEMPLG
HGKFALCERYRLGKALRNQYDMAIVLPNSLKSAFIPVFAKIAVRRGWKGENRYFLLNDLR
NNKRDYPMMVQRYVALAFEQNAVPKAADIPVLKPYLTVEPTQQAETLKNFEKQTALLGER
PIIGFCPGAEFGPAKRWPHYHYAKLAEMLIEKGYAVELFGSPKDVEAGEQIRNALPVELQ
QFCLNLAGQTNLNQAVDLIAHCTAVVSNDSGLMHIAAATDRPLVALYGPTSPTYTPPLSD
KAVIIRLIEGDLIKVRKSTDSSEGYHQSLIDITPEMALEKLEALLAK

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	70	306	1.3e-55	0.8933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10916	PRK10916	0.0	1	346	1	344	ADP-heptose--LPS heptosyltransferase RfaF.
TIGR02195	heptsyl_trn_II	0.0	2	346	1	334	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0859	RfaF	2.31e-107	1	347	2	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	2.21e-92	69	326	1	247	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	1.69e-82	2	343	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR11999.1	5.85e-253	1	347	1	347
QOR13828.1	8.31e-253	1	347	1	347
QOR22994.1	4.81e-252	1	347	1	347
QOR15643.1	9.70e-252	1	347	1	347
QOR19581.1	1.96e-251	1	347	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	4.65e-135	2	345	2	343	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
3TOV_A	2.46e-14	182	345	187	345	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
2GT1_A	1.63e-09	1	292	1	284	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.63e-09	1	292	1	284	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.69e-09	1	292	1	284	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45042	1.72e-216	1	347	1	346	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P37692	2.29e-142	1	345	1	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	3.25e-142	1	347	1	345	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
Q9R9D5	6.54e-11	12	325	5	314	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	1.26e-09	12	325	5	314	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001088_00807.