CAZyme Information: MGYG000001089_03102

Basic Information

• Species: Clostridium sp000435835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp000435835
• CAZyme ID: MGYG000001089_03102
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	MGYG000001089_246|CGC1	34781.07	9.0991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001089	3268107	MAG	Sweden	Europe

• Gene Location: Start: 4235; End: 5110 Strand: -

Full Sequence      

MVCFVILHYMAFEETKSCVNSILNNVEGEKKIIIVDNASSNLSGEALTEYYKNYKNVDII
ISDKNLGFANGNNVGYRYAKDKYSPDFIVVMNNDMEILQSNFIDEIYKSYEKYKYYIMGP
DIYSTKKKYHQNPQAENNYTLKELKYKRKVLLIKNNMRFLYKIKWGILSKIKNKNNNYKE
VVERKNFVDRVIKNKPLHGSCYVFSKDFINCKNECFYNKTFMYMESYILHYQAMRDNMLM
IYYPNIKIYHHEDVSTDYTYDNRYKKAIFSIKCLLESCNAYISLIEDDKNK

Enzyme Prediction     

No EC number prediction in MGYG000001089_03102.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	162	1.7e-18	0.9058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.42e-19	5	105	2	94	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.97e-16	1	257	4	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.03e-10	3	97	1	91	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04185	GT_2_like_b	1.19e-08	16	94	13	89	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.38e-08	5	106	2	98	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAI34126.1	2.56e-110	1	291	1	292
CAI34152.1	2.56e-110	1	291	1	292
AOW75273.1	5.77e-90	1	290	1	284
AER16975.1	8.73e-90	1	289	1	281
AEH57462.1	8.73e-90	1	289	1	281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU63	7.40e-08	5	238	23	211	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001089_03102.