CAZyme Information: MGYG000001091_02246

Basic Information

• Species: Citrobacter_A sp009363175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sp009363175
• CAZyme ID: MGYG000001091_02246
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239	MGYG000001091_557|CGC1	26730.91	10.4938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001091	4193018	MAG	Sweden	Europe

• Gene Location: Start: 10006; End: 10725 Strand: +

Full Sequence      

MKKGVFAFLRRVMWRVAIVLAVFWGGGIALFSIVPVPFSAVMVERQIGAWLQGDFGYVAH
SDWVSMDEISPWMGLAVIAAEDQTFPDHWGFDVAAIEKALSHNERNENRIRGASTLSQQT
VKNLFLWDGRSWLRKGLEAGLTVGVETVWSKKRILTVYLNIAEFGDGVFGVEAAAQRYFG
KPASRLTQSEAALLAAVLPNPLRFKAAAPSGYVRSRQAWILRQMRQLGGESFMTRHHLH

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	58	225	2.6e-56	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	8.92e-147	2	237	1	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.09e-96	5	230	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.24e-85	6	236	18	252	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.57e-72	57	225	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	7.30e-48	63	228	4	169	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFS73832.1	1.90e-172	1	239	1	239
AKE60250.1	5.46e-172	1	239	1	239
QPB32846.1	7.44e-170	1	239	1	239
QZA36900.1	7.44e-170	1	239	1	239
QZE45327.1	1.50e-169	1	239	1	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	9.87e-29	63	228	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.85e-28	63	228	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	8.61e-23	76	228	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	1.15e-20	76	201	55	180	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5ZZK_A	5.54e-19	61	226	57	228	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AQ99	1.61e-152	1	239	1	242	Biosynthetic peptidoglycan transglycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mtgA PE=3 SV=1
Q32BC5	7.00e-147	5	238	8	241	Biosynthetic peptidoglycan transglycosylase OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=mtgA PE=3 SV=1
C4ZSU7	2.01e-146	5	238	8	241	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=mtgA PE=3 SV=1
P46022	2.01e-146	5	238	8	241	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=mtgA PE=1 SV=1
B7M0S6	2.01e-146	5	238	8	241	Biosynthetic peptidoglycan transglycosylase OS=Escherichia coli O8 (strain IAI1) OX=585034 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999834	0.000097	0.000004	0.000001	0.000000	0.000114

TMHMM  Annotations     

start	end
12	34