CAZyme Information: MGYG000001091_02914

Basic Information

• Species: Citrobacter_A sp009363175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sp009363175
• CAZyme ID: MGYG000001091_02914
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		54476.9	6.8167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001091	4193018	MAG	Sweden	Europe

• Gene Location: Start: 7757; End: 9214 Strand: +

Full Sequence      

MQVIIDNVPYAPVCNSSARIGIAISTHNRADVLSRALAQHMKFLPAGALVVVVDDGSKPA
AVVPAGVQLVRQETSFGIVASKNASLTALMDAGCEHLFLWDDDAWPIADGWHLPYIESPE
PHLAYQFLDLAGPRKLNDLAVLYSDDKHVAYTGQRGVMLYYRRSAIERVGGFDWIYGRGM
YEHSDLALRIHNAGLTTWAYADVIGSDKLIHSLDEHEAVDRSVPTAARKALVDLNVKIHN
RRRDTGYTGYVEYRQQRDVVITTLLTSQPDPQRSSRMQPDPAALTTWAKSIRGADAVVLA
DQLTSAPDGAQLVTVPDVAMNVYFRRWLHIWQHLRDHPEYRFVWCTDGTDVEMLCAPWEE
MEAGKLYVGSEPKTYADAWAKQNHPERIYQEFIEQHRNDVMLNAGLLGGTRADVMAFAHG
IIRLYYRIESYRFWKKEQAGGAVGDMLAFGIVAKSFGDRIVTGPRIHTVFKSDGVGKEYA
WWKHK

Enzyme Prediction     

No EC number prediction in MGYG000001091_02914.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.00e-10	16	204	1	216	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	2.77e-07	22	195	1	152	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	9.10e-07	22	194	1	151	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06420	GT2_Chondriotin_Pol_N	2.13e-04	24	194	3	166	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.
pfam00535	Glycos_transf_2	0.001	22	129	2	116	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SAZ42700.1	0.0	1	485	1	485
AUZ65785.1	0.0	1	485	1	485
QPB30460.1	0.0	1	485	1	485
AUO64102.1	0.0	1	485	1	485
AUZ66754.1	0.0	1	485	1	485

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001091_02914.