CAZyme Information: MGYG000001091_04170

Basic Information

• Species: Citrobacter_A sp009363175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sp009363175
• CAZyme ID: MGYG000001091_04170
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000001091_1058|CGC1	17943.84	9.8544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001091	4193018	MAG	Sweden	Europe

• Gene Location: Start: 1963; End: 2439 Strand: -

Full Sequence      

MWRLVFLLLLPFSFYVRAFCFDAAGQKYHVDPLLIEAITIGESSKRPGITHANRSPKTGK
VVSTDYGLMQINSIHIPGLIKKGFINSAQDLLTRPCLNVQIGTWILAGHFQVCGISWNCL
GSYNAGFRQDRHETREAYADRIYRIYANLLRERRGIAL

Enzyme Prediction     

No EC number prediction in MGYG000001091_04170.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	8.05e-39	28	148	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	3.95e-32	1	149	1	142	type III secretion system invasion protein IagB.
PRK13722	PRK13722	6.82e-24	2	158	4	153	lytic transglycosylase; Provisional
pfam01464	SLT	3.33e-19	21	139	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.02e-11	19	126	141	240	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO67204.1	7.43e-112	1	158	1	158
APG19864.1	1.23e-101	1	158	1	158
CAX68115.1	9.06e-86	1	158	2	159
QKV88055.1	3.60e-81	5	158	8	161
AOE39920.1	1.47e-80	5	158	8	161

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	2.37e-12	20	111	3	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X6H3	2.48e-38	20	149	28	156	Peptidoglycan-binding-like protein OS=Escherichia coli O157:H7 OX=83334 GN=pbl PE=3 SV=1
Q46790	2.30e-34	20	139	28	146	Putative peptidoglycan-binding-like protein OS=Escherichia coli (strain K12) OX=83333 GN=pbl PE=5 SV=2
P14499	1.16e-22	2	146	4	142	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P17738	1.16e-22	20	158	22	153	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	2.30e-22	20	149	22	145	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000545	0.998774	0.000214	0.000151	0.000155	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001091_04170.