CAZyme Information: MGYG000001093_00079

Basic Information

• Species: Flavobacterium lindanitolerans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Flavobacterium; Flavobacterium lindanitolerans
• CAZyme ID: MGYG000001093_00079
• CAZy Family: GH114
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001093_10|CGC1	36648	4.5622

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001093	3659018	MAG	Sweden	Europe

• Gene Location: Start: 22555; End: 23529 Strand: +

Full Sequence      

MKKLVLLAIVLAFLGCDKDNDATTPDIENRDFRQDMRNFVIGISQKAKSIKPGFAVIPQN
GIELVTVNGEADGSPSQDYLNAIDGNGQEDLFYGYDNDDQATPTSVSNYLKGFLNVSKSN
RKTILVTDYCTTPSKASNSYQVNAANGYISYAAPKRDLTAIPATTPNNSNDAVVANLSQA
KNFLYLINSENFTSKLAFINAVKATNYDVIIMDLFFNDEQFTAVEINQLRNKANGGKRMV
ICYMSIGESENYRYYWQPSWNTSKPVWMATENPDWPGNFKVKYWNDDWQKIIYKNDNSYL
NKIIDANFDGVYLDIIDAFEYFER

Enzyme Prediction     

No EC number prediction in MGYG000001093_00079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	201	320	1.8e-19	0.5421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2342	COG2342	1.03e-41	184	324	21	156	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
TIGR01370	TIGR01370	4.24e-36	158	321	18	174	extracellular protein. Original assignment of this protein family as cysteinyl-tRNA synthetase is controversial, supported by but challenged by and by subsequent discovery of the actual mechanism for synthesizing Cys-tRNA in species where a direct Cys--tRNA ligase was not found. Lingering legacy annotations of members of this family probably should be removed. Evidence against the role includes a signal peptide. This family as been renamed "extracellular protein" to facilitate correction. Members of this family occur in Deinococcus radiodurans (bacterial) and Methanococcus jannaschii (archaeal). A number of homologous but more distantly related proteins are annotated as alpha-1,4 polygalactosaminidases. The function remains unknown. [Unknown function, General]
TIGR01370	TIGR01370	6.93e-11	29	158	181	307	extracellular protein. Original assignment of this protein family as cysteinyl-tRNA synthetase is controversial, supported by but challenged by and by subsequent discovery of the actual mechanism for synthesizing Cys-tRNA in species where a direct Cys--tRNA ligase was not found. Lingering legacy annotations of members of this family probably should be removed. Evidence against the role includes a signal peptide. This family as been renamed "extracellular protein" to facilitate correction. Members of this family occur in Deinococcus radiodurans (bacterial) and Methanococcus jannaschii (archaeal). A number of homologous but more distantly related proteins are annotated as alpha-1,4 polygalactosaminidases. The function remains unknown. [Unknown function, General]
pfam03537	Glyco_hydro_114	4.28e-10	203	320	16	113	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	2.88e-06	26	168	158	294	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALM48074.1	3.61e-160	4	323	7	326
AOE51695.1	3.61e-160	4	323	7	326
AWH85481.1	3.52e-155	1	323	1	324
AWG26125.1	2.06e-152	6	324	7	326
AWA30637.1	2.32e-146	1	324	3	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2AAM_A	2.79e-26	202	324	35	152	Crystalstructure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_B Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_C Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_D Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_E Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_F Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58872	5.53e-26	148	321	30	197	Uncharacterized protein MJ1477 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1477 PE=4 SV=1
Q9RWG3	1.08e-25	199	320	65	178	Uncharacterized protein DR_0705 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) OX=243230 GN=DR_0705 PE=4 SV=1
Q9X1D0	1.94e-25	202	324	49	166	Uncharacterized protein TM_1410 OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_1410 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001093_00079.