CAZyme Information: MGYG000001093_00701

Basic Information

• Species: Flavobacterium lindanitolerans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Flavobacterium; Flavobacterium lindanitolerans
• CAZyme ID: MGYG000001093_00701
• CAZy Family: CE14
• CAZyme Description: N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238		26674.56	5.4155

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001093	3659018	MAG	Sweden	Europe

• Gene Location: Start: 605; End: 1321 Strand: +

Full Sequence      

MKLDILFFGAHPDDVELGCGATIAKEVSLGKKVGIVDLTRGELGTRGTAEIRDEEAKNAA
AVLGVEIRENLKMRDGFFINDEAHQMQVIKMIRKYRPEIVICNAIDDRHIDHGKGSKLVS
DACFLSGLIKIETEIDGIAQAAWRPKLVYHYIQWKDLKPDFVVDVSGFMDKKVASLMEYK
SQFYDPNSNEPSTPIATKNFKDSILYRAQDLGRLINSEYAEGFTVERYLAVNSLGDLV

Enzyme Prediction     

No EC number prediction in MGYG000001093_00701.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	6	111	7.3e-26	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04001	thiol_BshB1	4.94e-122	2	231	1	226	bacillithiol biosynthesis deacetylase BshB1. Members of this protein family are BshB1 (YpjG), an enzyme of bacillithiol biosynthesis; either BshB1 or BshB2 (YojG) must be present, and often both are present. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
COG2120	LmbE	2.76e-41	1	183	9	195	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	2.47e-26	7	112	1	117	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALM50295.1	1.35e-151	1	238	1	238
AOE53914.1	1.35e-151	1	238	1	238
AWH85810.1	7.81e-151	1	238	1	238
QEE50069.1	1.51e-148	1	238	1	238
AWG25951.1	1.51e-148	1	238	1	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXD_A	3.02e-45	3	223	4	217	Crystalstructure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus],2IXD_B Crystal structure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus]
6P2T_A	3.89e-43	4	232	25	248	BshBfrom Bacillus subtilis complexed with citrate [Bacillus subtilis subsp. subtilis str. 168],6ULL_A BshB from Bacillus subtilis complexed with a substrate analogue [Bacillus subtilis subsp. subtilis str. 168]
1UAN_A	6.62e-37	3	223	2	213	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]
4XM1_A	9.29e-12	11	225	40	252	N,N'-diacetylchitobiosedeacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_B N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_C N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_D N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_E N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM1_F N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the presence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_A N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_B N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_C N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_D N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_E N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638],4XM2_F N,N'-diacetylchitobiose deacetylase from Pyrococcus furiosus in the absence of cadmium [Pyrococcus furiosus DSM 3638]
5BMO_A	7.10e-09	5	101	18	120	LnmXprotein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus],5BMO_B LnmX protein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus],5BMO_C LnmX protein, a putative GlcNAc-PI de-N-acetylase from Streptomyces atroolivaceus [Streptomyces atroolivaceus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81ST8	5.91e-46	3	223	4	217	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus anthracis OX=1392 GN=bshB1 PE=1 SV=1
Q81FP2	1.32e-44	3	223	4	217	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=bshB1 PE=1 SV=1
P42981	1.24e-42	4	232	5	228	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=bshB1 PE=1 SV=2
P71311	2.32e-10	5	112	19	131	Uncharacterized deacetylase YaiS OS=Escherichia coli (strain K12) OX=83333 GN=yaiS PE=3 SV=1
Q6F4N1	8.34e-10	5	183	34	219	Diacetylchitobiose deacetylase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=dac PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001093_00701.