CAZyme Information: MGYG000001093_01990

Basic Information

• Species: Flavobacterium lindanitolerans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Flavobacterium; Flavobacterium lindanitolerans
• CAZyme ID: MGYG000001093_01990
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000001093_116|CGC1	89488.36	6.7638

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001093	3659018	MAG	Sweden	Europe

• Gene Location: Start: 16250; End: 18607 Strand: +

Full Sequence      

MKNLPHSSTLTDLNPEAPAFPSRANTLTDEELLPEILFITSYPPRECGIATYSQDLMKAL
NNQYVSSFSLTVCALENDHERHHYSDEEVKYTLNTSDPSSFKAIAATINNDPTIKVVVIQ
HEFGLFRDHESFNLFLTEIKKPLAVVFHTVLPRPDEAFKQKVQQILDRADSIIVMTKNSE
AILLEDYTVVSEKISVIPHGTHLVPHNDKNALKAKYGVKGKKILSTFGLLSSGKSIETTL
EALPNIVDKSPDVLFLIIGKTHPGVVVNEGESYRDSLKEKIKELKLENHVQFVNKYLPLE
ELLDYLQLTDIYLFTSKDPNQAVSGTFSYAMSCGCAIVSTPIPHAKEMLQNGSGLTFDFG
NSKQLAEAVNQLIYDIGLRKNMILNGLHKIMHTAWENSAVAHAILFQKVSGGKIELHYRN
PKLNLDHIKKMTTEFGILQFSKLNRPDPNSGYTLDDNARALIALCQDYKLTRDIEDLKYI
SIYLNFISFCLSEDGKFKNYVDIDHNFTPQNNSVNLEDSSGRAIWALGYLISLAPILPSN
FTKKAETLFRKAMPQTEKMHSTRAMAFIIKGLYYFNRHIKDLDYKIYIEIFADRLVQMYK
HESSENWKWFESYLTYANSVLPEALLCAYAVTDNEEYREIAKDSFDFLLGNTFSENQIKV
ISNKTWHFKGQEKHSYGEQPIDVAYTILALRKFHDIFKDEEYLNKMEIAFNWFLGNNHLK
QIIYNPCTGGCFDGLEETNVNLNQGAESTLSYLMARLTIARYFGNPNTIYFRKKLKATKL
LLLKS

Enzyme Prediction     

No EC number prediction in MGYG000001093_01990.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	218	381	2.3e-19	0.94375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03822	GT4_mannosyltransferase-like	4.94e-76	36	407	2	370	mannosyltransferases of glycosyltransferase family 4 and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. ORF704 in E. coli has been shown to be involved in the biosynthesis of O-specific mannose homopolysaccharides.
cd03801	GT4_PimA-like	3.21e-37	36	399	2	358	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.95e-28	36	413	4	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	2.82e-24	48	403	15	361	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03819	GT4_WavL-like	4.58e-22	142	379	101	325	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEE50194.1	0.0	33	778	31	778
AWH86458.1	0.0	26	784	27	786
AWA31516.1	0.0	25	781	10	766
AWI27321.1	0.0	19	781	6	766
ALM50231.1	0.0	5	785	13	785

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1VEI4	2.28e-08	163	399	159	396	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) OX=504474 GN=mshA PE=3 SV=1
P46915	5.95e-08	209	373	179	339	Spore coat protein SA OS=Bacillus subtilis (strain 168) OX=224308 GN=cotSA PE=1 SV=1
Q4JSW2	1.21e-07	163	409	159	406	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium jeikeium (strain K411) OX=306537 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001093_01990.