CAZyme Information: MGYG000001093_02050

Basic Information

• Species: Flavobacterium lindanitolerans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Flavobacterium; Flavobacterium lindanitolerans
• CAZyme ID: MGYG000001093_02050
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001093_120|CGC1	42869	8.9958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001093	3659018	MAG	Sweden	Europe

• Gene Location: Start: 10189; End: 11304 Strand: +

Full Sequence      

MKYYIIAGEASGDLHGSNLMKAIFKKDPQAEIRFWGGDLMQEAGGTLVKHYRDLAFMGFA
EVVMNLKTILNNIKFCKADIQKFKPDAIIFIDYPGFNMRIAKWAKEIGIPTHYYISPQIW
AWKENRIKAIKRDVDFMYVILPFEKDFYEKKHHFPVEFVGHPLIDAIHNREHIDEDSFRK
EFDLDDKPVIALLPGSRKQEISKMLSEMLAVVKDFPAYQFVIAGAPSQEYDFYKQFLKDQ
NVHFISNRTYDLLSIASAALVTSGTATLETALFKVPEVVCYKGNWISYQIAKRIITLKYI
SLVNLIMDKEVVTELIQGECNPKRIRKELHKILETSQREKLLQDYEILEKKLGGIGASEK
TARLIVDKLKK

Enzyme Prediction     

No EC number prediction in MGYG000001093_02050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	2.9e-128	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.24e-129	1	371	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.97e-116	1	371	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.52e-90	4	366	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.55e-75	5	367	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.90e-57	1	365	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEE49237.1	1.35e-220	1	371	1	371
AXG73350.1	1.33e-215	1	370	1	370
QYJ69419.1	1.55e-214	1	370	1	370
BCY27529.1	1.87e-213	1	371	1	371
ALM48746.1	2.98e-212	1	369	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	8.16e-48	5	344	11	356	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.14e-47	5	344	11	356	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	2.63e-77	5	371	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B6J161	4.10e-71	5	365	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	5.78e-71	5	365	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	5.78e-71	5	365	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
A9NCA7	1.15e-70	5	365	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001093_02050.