CAZyme Information: MGYG000001094_00271

Basic Information

• Species: Azonexus sp900549295
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; Azonexus; Azonexus sp900549295
• CAZyme ID: MGYG000001094_00271
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		56142.32	8.4276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001094	3284523	MAG	Sweden	Europe

• Gene Location: Start: 19792; End: 21273 Strand: -

Full Sequence      

MQSLSWFAQAVFFLVVLAFGVYATLELRVFLISCRIEKRKLNAVVVPRTLQPGDVHPKVS
IFLPVYNESAVIERLIDAVCRLRYSASELEIFVLDDSSDVTSRLAQEKVAEYAARHVPVR
YLRRPERKNHKAGNLAYGVQHAQGEFFVIFDADFVPPDDFLLRTIPCFEDPELGFLQTGI
GYENCGKSFLTRFQAMEMGHQQYVTVGLSADGDMASLSGSSCVWRRRCVEALGGWNATTV
TEDVDLGYRAQFDHWKYAYLRDVVSMSVLPETVSAFRIQRERWGRGLIHSGFKHVRQVFQ
RDMGFMKRMNALAMMFSALLLAAVYGLVLLTLPLNFLIDFSGLAVPLGAGLFFIMVAIWA
LYNSYAAYQGARLTEKPGLLRLLWETYLYVAMFLPMAWYYFVGGVRALFGVYGGFHRTPK
GENEKNMPYPRLNSFLWFGEVFTFFYSGIAAIIAIDKQNYFLLPLNLTACLGFALVILWS
WQESREMRAVCKQ

Enzyme Prediction     

No EC number prediction in MGYG000001094_00271.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	57	286	1.5e-35	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06437	CESA_CaSu_A2	1.90e-113	57	287	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06421	CESA_CelA_like	5.17e-52	57	288	1	231	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06423	CESA_like	6.37e-45	61	243	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.55e-44	6	415	10	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06427	CESA_like_2	4.78e-35	57	297	1	240	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDJ50986.1	6.68e-234	4	485	5	486
QII86717.1	1.91e-233	4	485	5	486
AKQ61636.1	7.74e-233	4	485	5	486
AZW17412.1	7.74e-233	4	485	5	486
SNV65494.1	7.74e-233	4	485	5	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.29e-22	47	309	119	396	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.40e-22	47	309	131	408	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.40e-22	47	309	132	409	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	3.55e-22	57	338	273	549	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6YV7_B	8.73e-09	57	280	42	260	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6Z2T9	9.57e-38	57	286	141	376	Probable glucomannan 4-beta-mannosyltransferase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA6 PE=2 SV=2
Q6YWK8	3.21e-37	57	286	118	353	Probable glucomannan 4-beta-mannosyltransferase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA11 PE=2 SV=1
Q7PC70	7.32e-36	53	316	229	498	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC2 PE=2 SV=1
Q69L19	9.92e-36	53	289	229	471	Probable xyloglucan glycosyltransferase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC2 PE=2 SV=2
A2YHR9	3.14e-35	53	316	224	493	Putative xyloglucan glycosyltransferase 10 OS=Oryza sativa subsp. indica OX=39946 GN=CSLC10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
312	334
344	366
387	409
436	455
460	482