CAZyme Information: MGYG000001094_01055

Basic Information

• Species: Azonexus sp900549295
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; Azonexus; Azonexus sp900549295
• CAZyme ID: MGYG000001094_01055
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933		103487.74	7.2745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001094	3284523	MAG	Sweden	Europe

• Gene Location: Start: 12759; End: 15560 Strand: -

Full Sequence      

MKILRLFVAFCAFLPLLPFCSANALAATDIALYYGQHIPLKEFRVFDTIVVEPGHGHDPL
VWRAAGNELYAYVSVAEVQASRPYYARIPARWKLAKNADWNSEVIDQTPPEWPDFFADEV
VAPLWNKGYRGFFLDTLDSYRLAPDFDEQAQQQGLIRVIETLHKRFPGIALILNRGFEIV
PAVKDKIRMVAAESLFRRWSAGGARYDEVPAADREWLLAQLNAIRQRDGVEILVIDYVPP
HERQLARETADKIRSLGFTPWVTDAKLESIGVGRIEAVPRRVLIVYDSKESPALNYANAH
RFLQLPLNHMGYVVDYADVQKPLPDEVFSDRYAGVATWFSGGIAAGRQRPLIQWLGKRLE
QRMPLAIIGDPGFQVDRGFAARLGLKTTDAQIRQPLNISRQHAMMGFETAPMVSRHDHPS
LQAAGTPPEQTLLELRDADGQHYLAGAIQPWGGFILDPFVLIEVPGSEQARWVIDPFAFL
QGALRLPAMPVPDTTTENGRRLFFSHIDGDGFPSRAELPGSPFAAQALLDEILSAYRIPT
TVSVVESEVAPHGLYPKLSPQLEDIARRIFRLPHVEIASHTWSHPFVWDTSVTGVTGNKN
REEGLYHLDIPGYTFDAERETAGSAAYIRDRLAPPGKPVKILLWSGDTAPGADTLRVTEQ
AGLLNMNGGDTSITRANPSLTAVGALGIEKSGFLQVYAPITNENIYTNLWTGPYYGYEKV
IESLEMTNAPRRLKPVDLYYHTYSASKRAGLNALHKAFAWTKTQELHPVFASEFIRKVQD
FHAIAIARDNGGWRIRGNGQLRTLRWNGAAPRLADAVSVAGYRAGSEGWYIHLGGGAAWF
AADEKKADAAPSRPFLLDANARLSEWQATPARLAFKLNGHAPVEFSLANLAGCAVRIDGK
QAAPGRRKTQDALSVHSFGSPHASARVEVDCAR

Enzyme Prediction     

No EC number prediction in MGYG000001094_01055.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	47	267	2.9e-79	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10922	CE4_PelA_like_C	2.64e-133	498	764	1	266	C-terminal Putative NodB-like catalytic domain of PelA-like uncharacterized hypothetical proteins found in bacteria. This family is represented by a protein PelA of unknown function that is encoded by a gene in the pelA-G gene cluster for pellicle production and biofilm formation in Pseudomonas aeruginosa. PelA and most of the family members contain a domain of unknown function, DUF297, in the N-terminus and a C-terminal domain that shows high sequence similarity to the catalytic domain of the six-stranded barrel rhizobial NodB-like proteins, which remove N-linked or O-linked acetyl groups from cell wall polysaccharides and belong to the larger carbohydrate esterase 4 (CE4) superfamily.
COG3868	COG3868	3.34e-59	11	335	5	305	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	5.80e-19	29	267	3	219	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG2342	COG2342	9.91e-11	46	268	44	285	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd10585	CE4_SF	3.24e-08	502	647	1	128	Catalytic NodB homology domain of the carbohydrate esterase 4 superfamily. The carbohydrate esterase 4 (CE4) superfamily mainly includes chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan, respectively. Members in this superfamily contain a NodB homology domain that adopts a deformed (beta/alpha)8 barrel fold, which encompasses a mononuclear metalloenzyme employing a conserved His-His-Asp zinc-binding triad, closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. The NodB homology domain of CE4 superfamily is remotely related to the 7-stranded beta/alpha barrel catalytic domain of the superfamily consisting of family 38 glycoside hydrolases (GH38), family 57 heat stable retaining glycoside hydrolases (GH57), lactam utilization protein LamB/YcsF family proteins, and YdjC-family proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM20898.1	0.0	21	932	16	926
ABM31640.1	0.0	14	931	5	938
ATG95274.1	0.0	14	931	5	938
QCX11560.1	0.0	14	931	5	938
AVT12040.1	0.0	14	931	5	947

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TCB_A	1.99e-46	28	279	25	278	Structureof the glycoside hydrolase domain of PelA from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5TSY_A	1.28e-45	28	279	25	278	Structureof the glycoside hydrolase domain of PelA variant E218A from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000578	0.624637	0.374078	0.000283	0.000221	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001094_01055.