CAZyme Information: MGYG000001094_01361

Basic Information

• Species: Azonexus sp900549295
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; Azonexus; Azonexus sp900549295
• CAZyme ID: MGYG000001094_01361
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000001094_78|CGC1	37693.3	5.9356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001094	3284523	MAG	Sweden	Europe

• Gene Location: Start: 2805; End: 3836 Strand: +

Full Sequence      

MIRSIISGLFLAATVTLASAAAPLELVDNPPDRHVVVKGDTLWDISGKFLQKPWRWPEIW
RLNKDQIKNPHLIYPGDIVWLDLSDGSPRLRLGKPVIGQGKPQPKVYEEVIAQSIPSIPP
NVIEPFLSQPLIIEAGEEKTAPRIVATEEDRVLIGGGDLAYAKGIEGSDVIYWHVFRPGK
PLTDPETKEVLGHEAHFLGNAKLTRPGEPATLTVTLAKEDIHYGDWLKPAPPPTILAYVP
RAPEKEIRGQIMSIYGAISTGGPGSIITINRGEADGLENGHVIALYRKRTAAYMDDDVKR
LTTDIPDERYGLAFVFRSFERIAYALIVEGSKSVVIGDGVQNP

Enzyme Prediction     

No EC number prediction in MGYG000001094_01361.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1652	XkdP	2.85e-08	11	77	190	257	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
cd00118	LysM	4.81e-08	34	81	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK11198	PRK11198	8.32e-08	34	76	98	140	LysM domain/BON superfamily protein; Provisional
pfam01476	LysM	2.34e-06	34	81	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	2.71e-06	34	81	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM18232.1	9.06e-155	1	343	1	340
AXS78577.1	4.36e-144	1	343	1	343
QKV58263.1	1.43e-143	1	343	1	347
QRJ64382.1	1.66e-124	5	343	4	343
SMB22060.1	3.57e-118	24	343	53	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6VE2_O	1.78e-77	1	343	1	341	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]
3JC8_Ta	9.30e-21	22	338	69	397	ChainTa, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tb Chain Tb, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tc Chain Tc, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Td Chain Td, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Te Chain Te, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tf Chain Tf, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tg Chain Tg, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Th Chain Th, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Ti Chain Ti, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tj Chain Tj, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tk Chain Tk, LysM domain protein [Myxococcus xanthus DK 1622],3JC8_Tl Chain Tl, LysM domain protein [Myxococcus xanthus DK 1622],3JC9_Ta Chain Ta, TsaP [Myxococcus xanthus DK 1622],3JC9_Tb Chain Tb, TsaP [Myxococcus xanthus DK 1622],3JC9_Tc Chain Tc, TsaP [Myxococcus xanthus DK 1622],3JC9_Td Chain Td, TsaP [Myxococcus xanthus DK 1622],3JC9_Te Chain Te, TsaP [Myxococcus xanthus DK 1622],3JC9_Tf Chain Tf, TsaP [Myxococcus xanthus DK 1622],3JC9_Tg Chain Tg, TsaP [Myxococcus xanthus DK 1622],3JC9_Th Chain Th, TsaP [Myxococcus xanthus DK 1622],3JC9_Ti Chain Ti, TsaP [Myxococcus xanthus DK 1622],3JC9_Tj Chain Tj, TsaP [Myxococcus xanthus DK 1622],3JC9_Tk Chain Tk, TsaP [Myxococcus xanthus DK 1622],3JC9_Tl Chain Tl, TsaP [Myxococcus xanthus DK 1622]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999036	0.000168	0.000174	0.000158	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001094_01361.