CAZyme Information: MGYG000001094_01837

Basic Information

• Species: Azonexus sp900549295
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Rhodocyclaceae; Azonexus; Azonexus sp900549295
• CAZyme ID: MGYG000001094_01837
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42236.3	9.7509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001094	3284523	MAG	Sweden	Europe

• Gene Location: Start: 5842; End: 6990 Strand: -

Full Sequence      

MSGTLRIALVAGEASGDLLGAHLIAALKEKLPQAVFYGIGGPRMEGQGMTCWWPMGELSV
MGYWDALKNYRRIAGIRRQLKKRLKRERPDIFIGIDAPDFNLGLEASLKAAGTPTVHYVS
PSIWAWRGARIHKIGRAVSRVLALFPMEPPLYRQAGIPVSYVGHPMADSIPLTTDRLAVC
EKLGLPNAVPIFALLPGSRRGELESMADTFIQTARLIRERYQPQAQFVVPLATRETRLQF
EAALYRQQAADMPFRLLFGHAQDAVGAAHAALIASGTATLEAALIKRPMVITYKIARFSY
WLMKRMAYLPYVGLPNVLCGRFVVPEFLQDAATPENLAEALNQLYVDKENAAAIEAAFTD
LHLQLRQNTAEKAAQAVLECLR

Enzyme Prediction     

No EC number prediction in MGYG000001094_01837.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	366	7.2e-132	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	0.0	5	382	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.38e-154	5	382	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.68e-121	7	377	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.27e-118	7	379	8	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	2.98e-47	9	344	231	569	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM19639.1	1.75e-212	1	381	1	381
AXS80027.1	3.37e-210	1	381	1	381
QKV56982.1	1.32e-202	2	381	3	380
QRJ62717.1	1.41e-185	4	382	2	379
AEV27031.1	1.21e-173	5	381	6	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.04e-113	5	379	7	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.16e-112	5	379	7	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47F79	1.93e-210	1	381	1	381	Lipid-A-disaccharide synthase OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=lpxB PE=3 SV=1
Q7NVY1	5.18e-157	3	382	6	384	Lipid-A-disaccharide synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=lpxB PE=3 SV=1
A1K6Q8	2.21e-152	6	381	4	378	Lipid-A-disaccharide synthase OS=Azoarcus sp. (strain BH72) OX=418699 GN=lpxB PE=3 SV=1
Q5NZG2	1.27e-151	6	381	4	378	Lipid-A-disaccharide synthase OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=lpxB PE=3 SV=1
Q1H152	1.03e-137	7	382	4	378	Lipid-A-disaccharide synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001094_01837.