CAZyme Information: MGYG000001095_00580

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_00580
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		48614.21	6.5082

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 2772; End: 4043 Strand: +

Full Sequence      

MKLFRVIPILILTYLMSCNSMQNTIKHKSASEILGNPDYLAMSYGGYRTNSRRVQPTVSQ
LKEDMKILSAIGVKIIRTYNVHLPEAVNVLKAIKELRQENPEFEMYVMLGVWIDCKNAWT
GFEPNHNEESERNASEIAHAVELANEYPEIIKVIAVGNEAMVKWATAYYVQPSVILKWVN
HLQNLKKKGELPKDLWITSSDNFASWGGGDKEYQTKELNELIKVVDYISMHTYPMHDTHY
NPVFWGISEDEFQFSKEKQLDLAMNRSVNYAKSQYNSVKKYMQSLGIDKPIHIGETGWAT
FSNELYGSNDSKAVDEYKAGIFYHKMRDWTNEAGISCFYFEAFDEPWKDAGNSGGSENHF
GLFTVDGNAKYAVWNLVDEGAFKKLKRDGNTIQKTFNGNLKRLLDSVEMPPHREFEKQLL
ETK

Enzyme Prediction     

No EC number prediction in MGYG000001095_00580.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	62	373	1.4e-28	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5309	Scw11	1.67e-18	29	366	35	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
pfam00332	Glyco_hydro_17	1.24e-10	74	373	17	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VFB04068.1	6.81e-311	1	423	1	423
QQV02671.1	6.81e-311	1	423	1	423
QZO83107.1	5.55e-216	1	411	1	413
QDE20671.1	1.06e-213	1	411	1	413
QWU97811.1	1.06e-213	1	411	1	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FCG_A	3.00e-192	7	411	9	421	Crystalstructure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2QN74	7.27e-11	56	373	400	673	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
Q0CI96	1.58e-09	52	370	367	641	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
D4B2W4	5.02e-09	291	371	216	297	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
B8NTP7	3.56e-08	17	348	352	647	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2
Q2U492	3.56e-08	17	348	352	647	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000053	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001095_00580.