CAZyme Information: MGYG000001095_00887

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_00887
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42072.98	7.8225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 1396; End: 2499 Strand: +

Full Sequence      

MKYYIIAGEASGDLHGSNLMKALKQKDSTAEFRFWGGDLMAQQGGTLVKHYRDLAFMGFL
EVAMNLRTILNNIKFCKEDIKNNRPDVLILVDYPGFNLRIAKFAKELGIKVVYYISPQLW
AWKEGRVEIIKKYVDEMMVILPFEEDFYKKHGVHSHFVGHPLLDAISTLQNIDVEEFKKE
NDLNEKEIIALLPGSRKQEVEKMLEMMLSVRPYFKEYQFVIAGAPSLPKEFYQSYVDENV
HFVSNKTYDLLRCSKAALVTSGTATLETALLNVPEVVCYRGSKISYAIAKRLVKNIKYIS
LVNLIMDREVVKELIQNDLNTNNLVEELKKILETEKRTPLLRDYDLLREKLGGKGASENA
ADVILKV

Enzyme Prediction     

No EC number prediction in MGYG000001095_00887.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	350	1.4e-126	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.12e-130	1	367	2	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.50e-119	1	366	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.59e-95	4	367	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.48e-79	5	365	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.55e-65	1	367	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWA40686.1	1.40e-261	1	367	1	367
AZA96589.1	1.92e-243	1	367	1	367
AZA88028.1	1.92e-243	1	367	1	367
AZA56112.1	1.92e-243	1	367	1	367
ASK30782.1	4.51e-242	1	366	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.68e-48	5	367	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.75e-48	5	367	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6ALW0	3.19e-78	5	367	14	385	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q2LVL8	3.27e-77	5	365	8	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	1.41e-72	5	367	11	379	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	2.28e-71	5	367	11	379	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	1.13e-69	5	364	8	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001095_00887.