CAZyme Information: MGYG000001095_02029

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_02029
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000001095_340|CGC1	41251.13	9.1536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 23277; End: 24353 Strand: +

Full Sequence      

MKRIVSVHLLNDYSGSPKVLMQLLKSWTKNGMDAHLFTSGGRKGFLSDIPKVKNHLFWYR
FSSNALIRILNFFLSQFFLMIKLLFFLKKSDLVYINTVLPFGAAIAGKLRGCKIIYHIHE
TSVKPKLFKNFLFETAKMTADKIVFVSEYLLKQESLINNQELLYNVLESDFAEKADRFRN
VEKEIPVVLMICSLKVYKGVDEFLELAKKNPSYIFKLVVNATEKEIQEYFKGREIPKQLI
IYPTQTDTHPFYQEASVILNLSHPDLWVETFGLTILEGMRYGLPAIVAPVGGVTELVEDN
KNGFLIDSKHTNELSEKLNYILKDPSVYKSFSEASYEKSLLFSEAYFERKSLDIISNL

Enzyme Prediction     

No EC number prediction in MGYG000001095_02029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	180	330	3.6e-23	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	2.15e-32	4	338	4	347	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	2.94e-29	7	351	3	352	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03820	GT4_AmsD-like	1.60e-24	10	344	9	342	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
COG0438	RfaB	2.96e-24	1	358	2	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.56e-21	186	338	3	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWA38912.1	1.27e-248	1	358	1	358
VFB03268.1	9.96e-246	1	358	1	358
QQV03414.1	9.96e-246	1	358	1	358
AZA77146.1	3.65e-209	1	358	1	358
AZA64345.1	8.56e-208	1	358	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I45_A	1.51e-10	198	337	42	190	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]
6N1X_A	2.12e-10	91	333	90	348	ChainA, Glycosyltransferase [Staphylococcus aureus subsp. aureus CN1]
6D9T_A	2.28e-10	91	333	106	364	BshAfrom Staphylococcus aureus complexed with UDP [Staphylococcus aureus]
5D00_A	5.08e-10	88	337	88	353	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
7EC2_A	2.75e-09	88	356	216	491	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05083	8.46e-14	10	346	11	340	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q58577	2.96e-12	91	343	85	334	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
Q48453	4.50e-10	74	316	59	317	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
P42982	2.76e-09	88	337	86	351	N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=bshA PE=1 SV=2
Q81ST7	8.90e-08	88	337	85	350	N-acetyl-alpha-D-glucosaminyl L-malate synthase OS=Bacillus anthracis OX=1392 GN=bshA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
65	87