CAZyme Information: MGYG000001095_02750

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_02750
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647	MGYG000001095_454|CGC1	71651.09	9.36

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 1233; End: 3176 Strand: -

Full Sequence      

MIKRFFILSSLCMVLGMSAQKSHTVVKGDTPYNIAKKYGLTVEELLKLNPKVKDGKLALG
DVLTVKNDKAASASSKTPVASKLVNNSQLGKIILQPKQTIYGITKQYRISETDLRKLNPE
LDAHMKIGDEITLPLESIKKYGGEQNVAVHTSPVEKPVETVAETHTTKASEDEYIVQQKD
NYYRISRQFNITKEELFALNPGLEEKGLKPGETIKIKKAGTKNSGADIFEENSNPKTKVD
SGNEKSSSNTTVSSEDDYVTYTVQQGDTVFSIVNKFGVTIDELIALNPELSKGLKTGMVL
KIKKLDPAYVKKNGDALSVVMMLPFGYSTGETQYRTMALDFLTGAKLAIERNARNGQKLD
IKIVDSGNEASFRNSLTQINPDNTDLIIGPFFKSNVVDVLDFTKNQKIPIVAPFANSPEL
YNYSNLIIVETNDQTYADKIVEEVKSAFSDQKIYVVADSKKENANYIKAGLEKTLKNPNI
TIVNSSADIQLDKNMMTGQSAPVIAILASDSDSAGEAFANRIIALSKEVQGVKAFSMHYA
PVFEKKVDDLSQANLVYLMDRKINTEGSFEKEILAAYKNKYCKTPPKFAIVGFDIVNDML
TRENKKGEIFKQMNKVQTQLATKFEFVKSKANGAYVNTGYRVIRLVP

Enzyme Prediction     

No EC number prediction in MGYG000001095_02750.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	2.55e-12	21	65	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	2.62e-12	18	303	328	592	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	8.90e-11	158	315	330	453	membrane-bound lytic murein transglycosylase D; Provisional
cd00118	LysM	1.77e-10	259	302	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd06268	PBP1_ABC_transporter_LIVBP-like	3.35e-10	338	484	16	169	periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type 1 periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWA37437.1	0.0	1	647	1	646
AZA87191.1	0.0	1	646	1	643
AZA95691.1	0.0	1	646	1	643
AZA59043.1	0.0	1	646	1	643
ALR31813.1	0.0	1	647	1	647

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	1.32e-09	13	302	19	268	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.019228	0.508819	0.471068	0.000331	0.000272	0.000263

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001095_02750.