CAZyme Information: MGYG000001095_02945

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_02945
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711		79398.6	9.1848

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 5893; End: 8028 Strand: +

Full Sequence      

MSKQGVSKISGNPNPVVGEKTTYMVTDWYPATPSGERNPALVTWELFKKRPDGSFTTTNI
KKVGDGGFTFGEVAAKNTYRLEAYLHQPEGKGSTTIDITPQPGEIPKINKVELRYADDSP
GTVFSYQEKLVASAQCVNLAGKKLLFTLWEDDTAGEGHNSKNKFVDSKEVVVSRTGTATA
EFILTKALMQKASQGERDPKELEFYVTVEYYKDRKHASENRVIKNPEYKPPVQPSQAPKS
TPKATGSPAASKPDSKKEASGIFDSFTETVRNTWNELWDWAESKGTVKPDKKPTAPKPEG
KTTSVVDHTEKQASDKKGKCFCNRDFTAEEFEKIIKGLRDSEPRVKKDSGYALFGASNCE
LPEEDKTIEKLRTQLNSLFTKYQINTCLRKLHFLAQVYHETDRLRTTLEYATKKDYKPYF
GRGLMQLTWESNYKIYKAYSGIDCVKDYDKIANNLSNACDSAGWYWKQGKVLGVGKRWKG
PADPPAYVKIQNPDYPKETITYTDGKTSGKYGTVNLGLIADDDKVDLISYLVNGGSNGLQ
ERRNYVLTLKNIFKYPQDCVNKDQKKTAASSGSTSVTIRLTRKWQTDKSTIGEFTIDNSE
IKGYILEEKGPDTTVSGIEQRVPVGTYNLEWHAGTKIKKGLKLYNDVVSKSRAILIHSGN
TADDTEGCLLPGSTKSKDFVGGSKVKLKEIFDYVEEIGIKDAKIIISQAYE

Enzyme Prediction     

No EC number prediction in MGYG000001095_02945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	324	468	6.7e-21	0.645021645021645

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18925	DUF5675	3.78e-27	580	696	2	114	Family of unknown function (DUF5675). This presumed domain is found in bacteria, archaea, alveolata and caudoviruses. Proteins in this family are typically between 133 and 179 amino acids in length.
COG3179	COG3179	7.72e-06	381	543	33	194	Predicted chitinase [General function prediction only].
pfam00182	Glyco_hydro_19	2.32e-05	417	466	105	154	Chitinase class I.
cd00325	chitinase_GH19	6.40e-05	393	466	52	152	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDP85772.1	0.0	1	711	1	712
SNV32205.1	4.11e-292	100	711	3	616
AZB25489.1	1.75e-184	367	711	2	366
QWA38038.1	3.63e-183	1	336	1	337
ALR29433.1	2.80e-128	1	352	1	372

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001095_02945.