CAZyme Information: MGYG000001095_03598

Basic Information

• Species: Chryseobacterium gambrini
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Weeksellaceae; Chryseobacterium; Chryseobacterium gambrini
• CAZyme ID: MGYG000001095_03598
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000001095_566|CGC1	37427.75	6.8372

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001095	4128611	MAG	Sweden	Europe

• Gene Location: Start: 1368; End: 2315 Strand: -

Full Sequence      

MQEHSGAILAQPKESVSGSLRQVRIAYFIMIHHKPAVFKELFEKIYTRDQFYLIHIDRKA
KVELTEEIQNYLVRFPNVYILESVNIVSGGFSMIQTELNAMEYLLNASVEWDYFINLSGE
DSPLKSQQIIRQFLTVNKGRNYIFYYDQKFYRPDTLQRIQNHFTELTHKISSYVYRREFM
KGVVPYIGGKWFMFTRETCVFLTNNKSVMDFEDYYLHTLLPAESFFQTVLMNTDFSDIIV
NDDKRAVLEKTFFSRDVYTDQFIESLKAGNHLFIRKIGSQPHQNLISYIENTYLLPLTEV
NEIERELKKHDRQNN

Enzyme Prediction     

No EC number prediction in MGYG000001095_03598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	25	247	1.9e-57	0.92

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	1.66e-26	25	247	1	224	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
PLN03183	PLN03183	5.92e-14	48	243	105	314	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWA40607.1	1.01e-205	1	315	1	315
AZB25419.1	4.72e-177	9	315	7	317
QQY31507.1	1.35e-176	19	311	19	311
VEE11773.1	1.35e-176	19	311	19	311
VEH19409.1	1.11e-175	19	311	19	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	2.17e-21	23	245	118	343	HumanXylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	2.18e-21	23	245	122	347	HumanXylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]
3OTK_A	5.26e-19	25	229	86	289	Structureand mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_B Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_C Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_D Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus]
2GAK_A	2.45e-18	25	229	86	289	X-raycrystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAK_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAM_A X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_C X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_D X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5QQ55	3.00e-26	15	246	204	437	Xylosyltransferase OS=Ciona intestinalis OX=7719 GN=xt PE=2 SV=1
Q5QQ54	5.48e-26	20	246	207	435	Xylosyltransferase OS=Ciona savignyi OX=51511 GN=xt PE=2 SV=1
Q9EPI0	5.11e-24	13	246	224	458	Xylosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Xylt2 PE=2 SV=1
Q5QQ50	4.20e-23	23	246	232	458	Xylosyltransferase 2 OS=Canis lupus familiaris OX=9615 GN=XYLT2 PE=2 SV=1
Q9EPL0	2.55e-22	23	246	232	458	Xylosyltransferase 2 OS=Mus musculus OX=10090 GN=Xylt2 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001095_03598.