CAZyme Information: MGYG000001097_01607

Basic Information

• Species: Prevotella pectinovora
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella pectinovora
• CAZyme ID: MGYG000001097_01607
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000001097_91|CGC2	37008.84	7.919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001097	3372203	MAG	China	Asia

• Gene Location: Start: 43256; End: 44236 Strand: +

Full Sequence      

MRKLLLSLVLALAGTLAVNAANKYDNPDTLFVARDGTAEFRNIDDAIEVCRAFMEYHKVI
FVKKGTYKEKLIVPSWLTNIEIYGEDRDNTIITYDDHANVFIPGTDRKMGTFRTYTVRVD
GNDITFRNITIENNAARLGQAVALHTQGDRLTFVNCRILGNQDTVYTGGINTRLYFKDCH
IEGTTDFIFGPSTAWFENCTILSRTDSYITAASTPQNVEYGYVFNRCKIVAAEGVSKVYL
GRPWRPYAHTLFMNCQLGKHILPVGWHNWSNTQNETTARYCEYDNHGEGAATKERAAWTR
QLTRKEAAKVTLENVFRQNGGWIPNV

Enzyme Prediction     

No EC number prediction in MGYG000001097_01607.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	316	1.2e-99	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.53e-71	32	311	4	290	Pectinesterase.
PLN02773	PLN02773	1.74e-71	30	309	7	289	pectinesterase
COG4677	PemB	4.66e-63	15	319	61	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	7.86e-60	32	308	15	278	putative pectinesterase
PLN02682	PLN02682	1.01e-55	20	307	61	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	3.48e-175	18	326	17	325
QVJ81978.1	4.02e-164	1	324	1	322
ADE82952.1	4.02e-164	1	324	1	322
AGB28242.1	1.13e-161	8	324	7	323
QJR97878.1	4.47e-160	12	324	1	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.50e-41	32	323	7	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.82e-40	32	323	11	308	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	6.13e-40	30	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.32e-39	30	295	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.79e-34	40	326	18	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	7.96e-55	32	307	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	3.59e-49	29	310	272	558	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	1.02e-48	29	323	276	577	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	5.77e-47	29	310	259	545	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q8GX86	1.29e-45	14	324	239	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999150	0.000156	0.000155	0.000147	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001097_01607.