CAZyme Information: MGYG000001098_00837

Basic Information

• Species: Eubacterium_R sp002493325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp002493325
• CAZyme ID: MGYG000001098_00837
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676		77850.44	6.4334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001098	2141975	MAG	China	Asia

• Gene Location: Start: 398690; End: 400720 Strand: +

Full Sequence      

MWFENDYRRIFMDMHLNDTNNEYLSLLDIDNFVDCLSDADVSSVVVKAKSHVGLHYWPGK
YGKMHRVLEKRNLDYVGEMIDKCHKKGINVIVYFSQVYDNYAYEKHPLWRLRSFAGTASR
FPIPQKHNRYGLVCPNNPNYQKYCHDILTELCEKYNFEGIFLDMPFWPWPCYCKHCTEKF
FKETGKMLPRIYNFDKKIWREYIHARQHWIQEFIEHNTKAIKDVNPNISVEHNMAAIGLN
WITGNVESHMLASDYAGGDYYGGYAEQSFMCKYYNNVTVNKPFSYITSRCDRNLFFHTVS
RTADDLLIHSINALVHNGAFSICDAMNPNGTITDELYHGAIKEVFAATKPLEKYVSGNIK
SDVAVWYNTNYKTNKNYIESPMNIASILREKNIAFDVIGSKNIKNIKSKVLCIADVQEIT
DQELADIINYVENGGCLFITGSLGNNKDFEKFLGIKQNGISKYTYSYIEPKECFKDQMKT
FDSKSPYPVEHTAIEADIIDSSVEVKATITYPYTTRSEDDFSAIHSDPPGIHTNLPAVTK
VSRKNGTAMWVAMPLELTKAHHCRQSIADMICSLYDNKQMEFISNAPAFVEIIKWEKNDE
TYLALINQQENTPIYPIDNITVQLKEKFAQFEILSDNNSGTEITIDNTLDNTTLNISKLG
VFCVLHLKDEKANTLV

Enzyme Prediction     

No EC number prediction in MGYG000001098_00837.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	28	164	8.3e-34	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02638	GHL10	1.52e-06	19	230	8	225	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.
COG1874	GanA	3.11e-04	77	237	71	262	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	0.007	44	170	98	206	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
cd03143	A4_beta-galactosidase_middle_domain	0.008	373	444	20	90	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
cd14745	GH66	0.009	80	163	75	164	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH23071.1	5.97e-197	1	668	1	676
BBD45930.1	1.55e-94	1	665	7	691
QNK60153.1	1.89e-84	2	625	5	648
BBH24081.1	4.49e-77	301	668	21	394
AVM44410.1	1.17e-67	7	625	17	644

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001098_00837.