CAZyme Information: MGYG000001100_01200

Basic Information

• Species: Weissella viridescens
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella viridescens
• CAZyme ID: MGYG000001100_01200
• CAZy Family: GT2
• CAZyme Description: Teichoic acid glycerol-phosphate transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000001100_167|CGC1	47890.58	7.4677

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001100	1591687	MAG	China	Asia

• Gene Location: Start: 3458; End: 4678 Strand: -

Full Sequence      

MNAKLRRTLERMYHKVVTATFTVVGRLPKRELFFFESFHGRQYSDNPRAIYEYIQSQHPE
ANCIWAVKKGFEQPFIDNDVPYVRRMGLNWLLTMPRAKYWIFNTRMPKWMKKTAGTTFVQ
TWHGTPLKRLGLDIQQVNMPDTDTQRYRENFRQESARWDYLISPNAYSTAIFKRAFAYDG
PVLEIGYPRNDILQDEEHLAANRRHVLQKLGLKEDQKIILYAPTWRDNQFHKKGAYKYDN
QFPFADVLALDSEIVVLLRTHYLVVDAFDIDQYQGRVLDCGKYPDIRDLYLISDLLITDY
SSVMFDYAFTKRQMLFYMYDEAEYNQEIRGFYFDPQKELPGAIVADKKELVAEIDQQLVS
PISPPVHPRYQAFCDKYCLTEQGTTASERLLATLTNQDKGERQLGE

Enzyme Prediction     

No EC number prediction in MGYG000001100_01200.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	9.86e-116	29	394	3	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	6.89e-84	21	398	16	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SPN72909.1	1.29e-108	4	396	1164	1552
QTN00810.1	6.17e-104	36	397	384	740
AHA30703.1	2.51e-103	7	394	311	696
AYW50622.1	4.30e-102	25	397	1162	1529
QHS23522.1	2.79e-101	5	396	322	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	2.29e-93	35	383	357	704	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	2.46e-92	35	383	357	704	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	6.80e-92	35	383	357	704	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2G1C1	1.06e-123	5	394	2	387	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P13485	5.72e-122	7	394	353	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q8RKI5	1.28e-107	1	388	1	387	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	1.05e-92	35	383	357	704	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P27621	2.69e-25	96	396	90	378	Teichoic acid glycerol-phosphate primase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001100_01200.