CAZyme Information: MGYG000001100_01483

Basic Information

• Species: Weissella viridescens
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella viridescens
• CAZyme ID: MGYG000001100_01483
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	MGYG000001100_222|CGC1	46573.44	7.5029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001100	1591687	MAG	China	Asia

• Gene Location: Start: 456; End: 1682 Strand: +

Full Sequence      

MTEVLKEILQLMTGYTIIYPVFMSVGWIVGAICFHTHREKAKVDIADEASVTIVVSMFNE
ADLIEETMAAIKKVTYENLKVVLVDDASTDETVAIVRHYIQKQHWTNCTLVEMSENGGKA
RALNFALTHYVDSDYITVIDADSIIDSAAISKLVENFDRPEIAAVTGKPIVRNRTTVLGT
LQALEYVSIIDTIKRAQQTLFHKIMTVSGVLVMYRVSSLKTVGGFNPQVMTEDIDVTWRF
YKFGYQIKYEPRAITHILVPEKLKGFIKQRTRWSIGGVEVFNQNIQWVLRQAGTGTKFLM
LEMFFSHLWSWSFIISTLDFVISVFPAHDFKLSVPIMFIYIFMMVFMTAVSLIRDGGTSK
ISVRDLFVWPIYYLFYWVINLVCSIKSEFVVLFTKKSTGTWVSPDRGV

Enzyme Prediction     

No EC number prediction in MGYG000001100_01483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	52	222	1.7e-33	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	2.18e-109	5	408	3	418	N-glycosyltransferase; Provisional
PRK14583	hmsR	1.92e-70	11	408	29	439	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd06423	CESA_like	1.29e-51	53	233	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.30e-51	13	379	12	393	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06439	CESA_like_1	1.71e-33	37	272	17	243	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOD85503.1	1.32e-289	1	408	1	408
QNN75289.1	2.45e-129	1	408	1	409
AHF19114.1	1.84e-114	5	407	4	402
QHM58163.1	1.84e-114	5	407	4	402
QAR69150.1	1.90e-114	5	407	5	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	3.26e-13	51	286	44	273	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	3.28e-13	51	286	45	274	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EJ1_A	6.70e-06	50	280	129	378	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	6.89e-06	50	280	141	390	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	6.90e-06	50	280	142	391	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GLC5	5.26e-65	14	407	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	1.04e-64	14	407	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q6G608	5.13e-61	14	407	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q8NUI7	5.13e-61	14	407	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q5HCN1	2.00e-60	14	407	5	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	34
304	326
336	353
366	385