CAZyme Information: MGYG000001101_00412

Basic Information

• Species: HGM11523 sp900756545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11523; HGM11523 sp900756545
• CAZyme ID: MGYG000001101_00412
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		40807.72	4.9218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001101	2035203	MAG	China	Asia

• Gene Location: Start: 9865; End: 10929 Strand: +

Full Sequence      

MNRLELVEKIKLVSERMKSIQNDSVDEVCKIGIIDINNWEWAQGVGLYGLFRYYEYCGEQ
QELDWICRWIDRNLEKGLPERNINTVAPLYTVAQVYEQTNDARYIQVCREWAKWVMEGLD
RTKFGGFQHVVSDGKNHMQLWDDTLFMTVLFLAKMGVIERNEAYIKECERQFLLHAQYLA
DRKTGLWFHGWTFDGNHNFADARWARGNCWITAFVPDFLDLTGIACGARDFMIDMLQAQA
EALCRYQDEGGMWHTLLDDKSSYVETSATAGFAYGILKSVRLGILDQSYLKPALKAAETV
MKQIDTDGTVLQVSYGTGMGKTLQDYRDIPICPMTYGQALVIMMLAELLNHIRD

Enzyme Prediction     

No EC number prediction in MGYG000001101_00412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	37	349	1.4e-104	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.08e-101	37	340	32	341	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.85e-93	13	349	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ98394.1	2.03e-133	7	352	13	354
SDS22765.1	1.98e-127	9	351	12	353
QUL58446.1	2.36e-127	2	352	5	354
AIQ43751.1	3.35e-127	2	351	5	353
ACZ10617.1	4.55e-127	10	353	12	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	5.29e-106	3	351	23	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.46e-106	3	350	24	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	2.64e-96	5	347	7	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	1.92e-26	37	326	37	340	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.26e-26	37	326	27	330	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.11e-52	39	350	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.05e-25	37	326	37	340	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.80e-09	147	328	1	199	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.80e-09	147	328	1	199	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001101_00412.