CAZyme Information: MGYG000001101_00539

Basic Information

• Species: HGM11523 sp900756545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11523; HGM11523 sp900756545
• CAZyme ID: MGYG000001101_00539
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000001101_14|CGC1	60259.98	5.359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001101	2035203	MAG	China	Asia

• Gene Location: Start: 715; End: 2337 Strand: +

Full Sequence      

MMTEDQISTILDDLTLDEMIGQMLCFNLADKYTEDDIRNIVKKTHAGSFFVAGVQPDRIR
VCTEIINQHTKLPAMIAADIENGPGHVLPGTVRLPSPMAWGACNDPSLIEEAHARTAAVC
RLAGIHWSFSPIVDINYNPDNPVTNIRAISDQPAQVEKIACAAIRGLQRDGWIMAGCKHF
PGDGVDDRNQHFCTTVNSLSKEEWINTYGRVYQAMFRENVASVMVGHIALPAYDEPLNAW
VGYPPGSLSRHLQTNLLREELGFDGCIVSDALSMVGACAAVPYDRLSVEFVKAGGDMLLF
PTAEYFNEIKNAVKAGEIPMERIRDAVRHILILKDRARLFEDQKKLLQSIPDPWDLQALS
DQIGEKSLHVVRDFDNILPLQLKQGDKILILNIKKDKNPETAFFCCDLTVVEEELRNRGF
QVKSYTNAARNDFQAELDECAAVLINCKMSSQDYAGGSLRIGWPHIAPFWRGAVLRHPKM
VFTSFGDPYKIYDFPYLKTYINAFSDSESTQRAFVKAILGEIPFLGKSPVGLPGYFSAEV

Enzyme Prediction     

No EC number prediction in MGYG000001101_00539.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	299	3.3e-46	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.54e-60	14	391	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.44e-60	15	333	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	3.07e-23	90	299	74	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.07e-21	7	385	38	411	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI68029.1	2.68e-115	11	540	17	545
QRP59270.1	3.55e-87	14	532	46	579
QQT78845.1	3.55e-87	14	532	46	579
ASM64656.1	3.55e-87	14	532	46	579
QUU06096.1	4.99e-87	14	532	46	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	3.13e-74	2	530	13	556	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	8.92e-42	10	391	38	458	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.26e-41	10	391	12	432	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.44e-41	10	391	42	462	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.10e-37	14	532	11	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	9.45e-67	7	530	19	553	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	4.88e-41	10	391	38	458	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q1H075	1.62e-24	20	299	3	281	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
Q82SJ8	1.04e-20	75	299	60	281	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
P48823	3.27e-20	124	381	155	426	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001101_00539.