CAZyme Information: MGYG000001101_00805

Basic Information

• Species: HGM11523 sp900756545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11523; HGM11523 sp900756545
• CAZyme ID: MGYG000001101_00805
• CAZy Family: PL21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1432	MGYG000001101_30|CGC1	157871.92	4.6854

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001101	2035203	MAG	China	Asia

• Gene Location: Start: 6747; End: 11045 Strand: -

Full Sequence      

MKKAAVCILVGLLLCTGKAYAYENVYEIFKYAAIEDIRGSEEWTVEEVTSGMSKSQISIS
SGKLVLRDNDYTDFKPLRLIRNFDPQKGKVYAEVEFSYAGNVQAANSLDIAIMQGEQEVA
AFSVSKDGTFYLGGNPVPGEKLQQSTTYTLKISCDTETKMVDYYLAGSQFAGKTGEQYTG
STGAVKRLCCPLFFDAECIDGLLIRTKENTGTYQISSMGVSELARPSEAHPRLYVNPEKA
EALRTKIETYGTDEAKTYTRAVVESDRYSAEDAATLTADKYHDGVRTAAEACALRYLLYR
DTTYGEKAKQMMFTYLETAQNVSSYGSIYNFGDVLQAAALTYDWCYDLYTDGEKEQFISL
LEQALKKQEISYPAVGSAVTGHSSGPQLMRNLLAAGVAVYGDKNEIYDISAGKFFREYID
FRKFLSPAGFHPMGLDYGPGRYVNELYAQYIFQVMGCGDVFDGALAKIPYSILYGRRPDG
QLFRDGDTYSDQYTRLGSYWKKTDVLGLAGSCFADPMFQFEYAKQKNKQKVLSNTLDLVL
FSSLSAGIGSDILPKSHYFSEPYASIIARTGWEANSAVAYMKIGGYQLNNHQHLDTGQFQ
LFYKGALAIDSGVYEGQNGSYFDDHDRNYNKRTIAHNCMLVYDPSEKFLNGAVANDGGQR
WPADAAEPYYFDDVLYGDRKVSQVMAHEIREDSGAVQYSYIKGDLTQAYQNTKVSEYQRS
MLFVPMEQQGRPAAFVVLDRVKSTNPDYKKYWLLHSITQPSVNGNTATIRHNGGQLVNTA
VLPENSNIETVGGIGAEFDVFGINYNGTLPGGPLTCAESGEWRIQISPKTASEEDIFLNV
MQMSDAGLTPLTAEKQAVGEMVGASFGDKLIFFSRNGEKNQADIPFQTQQKTDCVFADLT
PGYWEVYIGGSLQETILVSETGGTAGFTVPASSQCLLKKADTAELFLPAGNVRVSNVTDT
QAVLSWTPSNKKGVYEIIVNGSLAGQTTDTSYRLAGLSEAAAYSAVVRTLAGGSIVDSET
ARFTTAPKLPDNLQTERRNRDLSISWTPSPQAAAYALQIDGCEYGGLTECAYLLEDGAEA
PHEIRVRACGETDSLWSAAYQYSGMLCDFEESDGLDGWTPRMSGSSDVRLETVDGRGCMA
LIDHDFSTSNEYLSTASVQKQTADCYGKVVFKTQFLYKKYNHSTNNLEITISGTDLQNME
KTAIKMYVFSDGAFGYTIAEGTPFQFLPGKNPMVTVKENTWVQVTVVMDTNRQAIDLIVQ
SDMYKGYLGMPLGDYDPETGTCRINGMPFYSQDTSAQKKPNEIVALNKIYIGSSRYTGEY
YFDNVDMYMETDQDDLCVRQLAGNKTSETAALFTGCVENLSGKAHTVVFAIGEYTGAGRL
VQVQIGKHPVGAYETLWLKQGITAVNPGSALKAFVWDEDMRPAGKAVTHNDN

Enzyme Prediction     

No EC number prediction in MGYG000001101_00805.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL21	575	644	5.3e-30	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00063	FN3	3.89e-05	948	1025	3	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
pfam00041	fn3	1.52e-04	948	1015	2	81	Fibronectin type III domain.
pfam07940	Hepar_II_III	2.31e-04	591	803	39	211	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
smart00060	FN3	2.90e-04	948	1009	3	76	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
pfam18675	HepII_C	3.68e-04	859	930	5	80	Heparinase II C-terminal domain. Heparinase II (HepII) is an 85-kDa dimeric enzyme that depolymerizes both heparin and heparan sulfate glycosaminoglycans. The protein is composed of three domains: an N-terminal alpha-helical domain, a central two-layered beta-sheet domain, and a C-terminal domain forming a two-layered beta-sheet. The C-terminal domain contains nine beta-strands packed together in a manner resembling a beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHW00380.1	1.18e-140	222	906	63	771
BBH20141.1	1.08e-134	226	945	235	965
ABJ17170.1	5.38e-132	226	912	44	745
AAB18277.1	5.38e-132	226	912	44	745
ACU04612.1	5.38e-132	226	912	44	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2FUQ_A	9.77e-134	226	912	19	720	ChainA, heparinase II protein [Pedobacter heparinus],2FUQ_B Chain B, heparinase II protein [Pedobacter heparinus]
3E80_A	1.03e-133	226	912	21	722	Structureof Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_B Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus],3E80_C Structure of Heparinase II complexed with heparan sulfate degradation disaccharide product [Pedobacter heparinus]
3E7J_A	5.28e-131	226	912	21	722	ChainA, Heparinase II protein [Pedobacter heparinus],3E7J_B Chain B, Heparinase II protein [Pedobacter heparinus]
2FUT_A	1.87e-128	226	912	20	721	ChainA, heparinase II protein [Pedobacter heparinus],2FUT_B Chain B, heparinase II protein [Pedobacter heparinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6XZB6	1.08e-132	226	912	44	745	Heparin and heparin-sulfate lyase OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=hepB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001004	0.840478	0.157592	0.000294	0.000298	0.000289

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001101_00805.