CAZyme Information: MGYG000001101_01202

Basic Information

• Species: HGM11523 sp900756545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11523; HGM11523 sp900756545
• CAZyme ID: MGYG000001101_01202
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		42018.88	4.7362

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001101	2035203	MAG	China	Asia

• Gene Location: Start: 3464; End: 4564 Strand: -

Full Sequence      

MKEESLKYGIKMCETIMAKFPPDRIEPNVGMFTYHHGVFLSGMERIYHITEDRKYFEYIK
GWVDSVVTADGEIVPSDNPWCSLKTLDYRQAGILLFNLYRETGDERYKKVITTLTESLKS
YPVNSQGGFWHFADAPNEMWLDGLYMVSPLMAMYAAEFGKTEFFDMAVNQIIVMYSNMID
EDGLLHHGWDETKQAQWADQETGLSHEVWGRACGWFVVAISDILDELPKNHDKRNEIIDI
LRKTIANIAKYQDKSGRWYQIINKGNLADNWLENSCTCLYLYTIAKCMHRGYLSDEYMSC
LEKGFYGVINSLQEDGNGLILGEICSGIGIEDGSYAHYINWPVIQNDLHGTGAFVLMCSE
IYKLLA

Enzyme Prediction     

No EC number prediction in MGYG000001101_01202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	363	1.5e-99	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.67e-93	11	365	4	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.81e-87	34	365	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV69577.1	6.07e-125	6	364	19	371
AYV72033.1	6.07e-125	6	364	19	371
QJX61073.1	6.07e-125	6	364	19	371
QNF30158.1	2.62e-124	6	361	19	368
QNK55786.1	3.04e-121	11	361	16	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	2.37e-89	6	364	14	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.88e-89	6	364	4	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.07e-75	7	364	3	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	1.07e-23	36	337	69	356	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
5NOA_A	2.23e-11	27	316	49	333	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.30e-88	6	364	14	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.75e-23	149	360	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.75e-23	149	360	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	1.79e-07	140	361	201	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001101_01202.