CAZyme Information: MGYG000001101_01793

Basic Information

• Species: HGM11523 sp900756545
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11523; HGM11523 sp900756545
• CAZyme ID: MGYG000001101_01793
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		39230.71	5.1678

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001101	2035203	MAG	China	Asia

• Gene Location: Start: 14933; End: 15970 Strand: -

Full Sequence      

MLGRMVNERKLPPLKSREEMLDILLKEEYGYLPTAPESMRWKVTDNYIPNFCAGKAVIKK
VDITSCICGGEFTFPVYVTIPTEEGKHPFFVCINFRDCVPDRYIPIEEIIDNGFAVLSFC
YNDVTKDNDDFTDGLAGVLYKNLERDGDSAGKIAMWAWAAQRVMDYADSLDCLDKGCSIV
CGHSRLGKTALLAAASDERFCFAYSNDSGCSGAALSRGKEGETLQDICKTFPYWFCKNYQ
KYVDDEYNMPFDQHYLTASIAPRYVYIASAKEDTWADPKSEMLTCVAVDAMYKKCGKKGF
ICEDRLPEAGDEFHEGSVGYHLRNGLHYFSREDWLKVIKFIKRHQ

Enzyme Prediction     

No EC number prediction in MGYG000001101_01793.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	16	344	6.1e-68	0.9033457249070632

CDD Domains     

MGYG000001101_01793 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	8.59e-113	15	345	31	361
ALL53565.1	7.24e-78	15	344	33	358
QOV20253.1	4.08e-77	15	344	33	358
AEV29352.1	1.33e-68	6	344	6	368
QNK58798.1	4.06e-68	15	334	29	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	4.79e-53	3	340	16	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	7.23e-53	3	340	34	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.03e-52	3	340	45	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	1.99e-52	3	340	34	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	5.49e-52	3	340	34	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	1.23e-47	106	344	188	426	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
B2ABS0	1.11e-15	17	275	145	391	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
P0CT87	4.75e-15	17	296	133	403	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
G0RV93	8.30e-15	19	280	135	380	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
D8QLP9	6.93e-14	17	296	58	324	4-O-methyl-glucuronoyl methylesterase OS=Schizophyllum commune (strain H4-8 / FGSC 9210) OX=578458 GN=SCHCODRAFT_238770 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001101_01793.