CAZyme Information: MGYG000001103_00150

Basic Information

• Species: UMGS1600 sp900553315
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553315
• CAZyme ID: MGYG000001103_00150
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	MGYG000001103_32|CGC1	64843.9	5.3836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001103	2571825	MAG	China	Asia

• Gene Location: Start: 14914; End: 16638 Strand: +

Full Sequence      

MNWKDLDVSANFPAEIVCEEAGTGETCITLTWTKGEYKAPALNVTWAVPLVDIQYEWYPL
CGRDRALRTDWDAPIHTSFSTGAPVFCFYNEEGQNRLTIALSEVRLEALHSYGVHEEDGT
LLCRLKLPLPMTSSAERYSVTLLRLRENMRYEAALRQVAAWWERVSDTHPMPVPTAARLP
MYSTWYSFHQETVAADLEAACVLAAQDGFRTVIVDDGWQTSDCTRGYGYCGDWQPAPEKI
PDMRAHVARVHALGMKYMLWYSVVYVGEHSRHWETFKTMLLRHDTWAHAGILDPRFPQVR
AFLVDTYAKALKAWDLDGFKLDFIDSFGVSSDAPPVREGMDYALVEEAVCRLLTEVREAL
TAIKPDILIEFRQNYIGPAIRGFGNMFRVADCPADWLSNRVGMVDLRLLSGDTAVHSDML
MWHSEDSVENAARQLLNVFFAVPQISVRPDRVPEAHRAMLRHYLALMEQLQGVLTAPLRA
EAPHLLYPLVRARKDDTEVIVCYDADRVVRLSDAARTYVFNATGAEKLLLRGTNVVYRVY
DCLGREGKRGETAQAYAEAAIPSGGYAVLEAEGR

Enzyme Prediction     

No EC number prediction in MGYG000001103_00150.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.76e-66	177	469	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.04e-10	184	370	51	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	2.79e-08	180	399	2	191	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.15e-04	180	323	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14790	GH_D	2.02e-04	180	400	3	178	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU17504.1	5.94e-158	4	565	7	580
AIQ22829.1	1.84e-157	28	545	25	547
QOV11148.1	3.81e-156	40	549	45	563
AZN41080.1	1.12e-155	42	571	55	599
QWG32884.1	1.52e-152	40	552	44	565

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001103_00150.