CAZyme Information: MGYG000001103_00399

Basic Information

• Species: UMGS1600 sp900553315
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553315
• CAZyme ID: MGYG000001103_00399
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565		63728.26	6.9345

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001103	2571825	MAG	China	Asia

• Gene Location: Start: 7364; End: 9061 Strand: +

Full Sequence      

MGGLAKRVRAYVRLNGVGYTLRRGMEKVRDRGLREYDRLYRRERAGEAELAQQRERKWQA
APLVSILVPVYNTDPAMLRAAAESFRAQTYPHWEAILLDGASTKPETVQCLKELEKLDDR
LRVVFSGENLHISGNSNAALRHAKGEWIALCDHDDLYTPDALYWVMDAVERENPDFIYSD
EDKVSEDGRVFFEAHFKPDYCPDNLRSGNYICHLMVMRRSLIDAAGGFRSAFDGSQDHDL
ALRCMEHTTRVTHIPRVLYHWRHVGASMSHQNLMRCVDAARRAVEEHINRVGPGGAVSLD
HNCLRVHYSIAEKKPVSIIVLDSGDEAQLEKCLTALRATDWPQTELLVVTERKELPGVVC
VPRRGAGRFAALNLGAARAKGDYLAFVDSSVTVEKPDWLTELVMLAQREEIIAAVPVLFD
ERGHILHAGYALGMKHVASCRQQGLPRTAGGWHGLEHQAHNVGAVSAACLVMRRERFEPF
EENWQSDLGSVAWSVQLREKSGWLAFTPFSTAIGTANAPVLRDGQSWPEEENRFPVLTDP
CYSPHFSHMKANFHLNTDDKGRNVF

Enzyme Prediction     

No EC number prediction in MGYG000001103_00399.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	65	220	4.8e-29	0.9588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	8.55e-102	62	262	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd06433	GT_2_WfgS_like	1.86e-28	65	270	1	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	8.68e-27	65	222	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.90e-24	66	246	1	149	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04196	GT_2_like_d	1.14e-17	65	267	1	213	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA52451.1	6.20e-139	3	562	4	557
QTE73693.1	1.35e-137	7	553	6	544
QTE72709.1	7.64e-137	7	553	6	544
QUC66659.1	1.46e-134	1	553	3	546
QTE67019.1	8.77e-120	1	553	1	541

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.59e-71	56	557	360	899	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.26e-51	51	547	308	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
O32268	4.54e-13	62	188	6	130	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
P71054	3.10e-11	60	280	3	225	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
B5L3F2	1.97e-09	63	246	5	181	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfgD OS=Escherichia coli OX=562 GN=wfgD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999816	0.000174	0.000008	0.000001	0.000000	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001103_00399.