CAZyme Information: MGYG000001103_00651

Basic Information

• Species: UMGS1600 sp900553315
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553315
• CAZyme ID: MGYG000001103_00651
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000001103_89|CGC1	35605.41	5.486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001103	2571825	MAG	China	Asia

• Gene Location: Start: 1047; End: 2018 Strand: +

Full Sequence      

MEPMTPVRHRRADRYRELPAEAPQEASAENVQEPIQEPIASSPTLRAQTPPRPAALRAPR
PQLPLEAEAAAPMERPPRAAASRKRPQEKVKADTHRMPTWLTITICVCILLCGALFAGEC
LMRAYLTQRQNEREAAYQRVVDAHPLPSDIRTLIEQYAAENNLQPAFVASIVLNESSYRT
DAESGVGARGLMQLMPETAQWIAGKLKLENYSFAMMYDAETNIRFGTWYLNYLAGLFQGD
PTLVACAYHAGQGEVRGWLSDPGLSEDGVTLKLENLADGPTKTYAGRVTRDYGIYEALYY
TPAETPADVAADAGAGLLRGSVR

Enzyme Prediction     

No EC number prediction in MGYG000001103_00651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	161	292	2.6e-22	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.43e-59	151	294	5	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.09e-40	143	298	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
381594	cd00254	3.50e-26	165	259	1	89	LT-like lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.33e-25	47	299	37	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.64e-22	154	260	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE68505.1	1.70e-70	78	308	231	459
QTE71168.1	5.02e-67	78	315	236	469
QTE75132.1	5.02e-67	78	315	236	469
QUA53916.1	2.28e-66	83	315	247	474
QUC68078.1	2.64e-66	78	300	234	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	7.77e-20	148	302	414	562	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	7.81e-20	148	302	418	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	7.88e-20	148	302	424	572	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	7.92e-20	148	302	428	576	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	7.98e-20	148	302	434	582	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.15e-13	147	311	477	638	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.15e-13	147	311	477	638	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	2.15e-12	147	299	477	625	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	2.96e-11	154	317	1426	1593	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.96e-11	154	317	1426	1593	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
99	118