CAZyme Information: MGYG000001103_01180

Basic Information

• Species: UMGS1600 sp900553315
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553315
• CAZyme ID: MGYG000001103_01180
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000001103_189|CGC1	42220.47	6.1419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001103	2571825	MAG	China	Asia

• Gene Location: Start: 4637; End: 5797 Strand: -

Full Sequence      

MRLHAKPAKDKTAGLIRLGMGWMLMLSMALVPGNRALYAPDGAEALAADTPRQHKVIAYV
QDMAGLSLREEDAPYLDQVNYAFALLKDGKAHGDQWKSVHVVKDYLQRHPHITGVISVGG
WGAEGFSDAASTPEGRETLARSMLQLMDAHGFRGLDVDWEYPATSAGGLKHRADDWENYF
QLLALLREGLDARAEATGQVYVLSVALGASDSLIQAVDGTRLGALVDQANIMTYDFTGFD
TMTGHHAALYPAGDSKLGGAYAIHAYAAQGIPTEKLNLGCAFYGRAWRDTPAENNGLHQR
AGTTGSKYYTYDQLQSLLTKEKYTRYYDAEAQSPWLFDGSTFISYEDASSLRAKAAYVRA
NSLHGIFCWALDHDPSGELLRAMGEK

Enzyme Prediction     

No EC number prediction in MGYG000001103_01180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	72	376	1.7e-63	0.847972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	6.95e-81	72	374	22	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	2.50e-76	55	374	1	334	Glyco_18 domain.
COG3325	ChiA	8.14e-69	33	385	19	434	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	8.17e-69	72	374	19	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.92e-54	79	374	31	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS82416.1	8.18e-78	23	383	2	357
AUS97898.1	8.01e-77	56	380	12	340
QLG42679.1	8.96e-77	23	383	2	357
BAA13974.1	2.59e-76	23	383	19	374
ANY73914.1	3.65e-76	52	383	2	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	3.72e-68	52	383	3	338	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5GZU_A	3.70e-64	53	380	25	383	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.54e-63	53	380	276	634	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6KXN_A	7.08e-53	54	386	7	369	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	7.08e-53	54	386	7	369	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	8.47e-45	93	379	131	443	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q95M17	1.28e-29	81	374	56	365	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
O81862	1.76e-28	107	385	85	364	Class V chitinase OS=Arabidopsis thaliana OX=3702 GN=ChiC PE=1 SV=1
Q9D7Q1	5.16e-28	108	374	86	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
G5EAZ3	2.16e-27	107	378	84	351	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.165726	0.831089	0.002088	0.000364	0.000298	0.000420

TMHMM  Annotations     

start	end
13	32