CAZyme Information: MGYG000001106_00612

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Pygmaiobacter
• CAZyme ID: MGYG000001106_00612
• CAZy Family: GT1
• CAZyme Description: Oleandomycin glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		26328.22	5.8672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001106	1936587	MAG	China	Asia

• Gene Location: Start: 1280; End: 1987 Strand: -

Full Sequence      

MLLMMPKINRQIRRLQENGYPVKGILDIVQNDNETDTIVYTSSFFQPCADTFSDRYHFIG
PSIRPVESAVKKLAEKTIYISMGTVNKNKNFYFNCIEALKTTGYQIIISMGTNRDCLGDL
SDQIQVYDFVDQMAVLSISDVFITHCGMNSASEGLYFEVPLILFPQTPEQGAVAARVQEL
GAGVRLGSIDKEEIARAVDRVLKEPVYRENAVRISKSFKACGGVREAKEFIESKG

Enzyme Prediction     

No EC number prediction in MGYG000001106_00612.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	66	233	4.9e-37	0.41361256544502617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	1.61e-50	15	232	162	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	9.85e-45	37	234	197	398	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	7.35e-39	13	232	169	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
pfam00201	UDPGT	4.95e-10	126	215	326	419	UDP-glucoronosyl and UDP-glucosyl transferase.
cd03785	GT28_MurG	1.79e-09	94	218	202	338	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI66858.1	1.19e-99	1	232	123	355
AQS58446.1	1.22e-94	2	232	151	383
QKH46522.1	2.67e-82	1	232	153	386
BAD62794.1	5.42e-73	1	234	151	388
AST95411.1	5.42e-73	1	234	151	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	7.62e-25	38	233	179	383	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	8.05e-25	38	233	179	383	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6J31_A	2.89e-23	15	232	165	391	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	2.97e-23	15	232	168	394	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
2IYA_A	3.80e-20	38	232	214	417	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05496	4.38e-36	19	232	165	387	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
O31853	2.83e-34	22	231	174	392	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
Q65JC2	2.65e-29	38	233	182	388	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O34539	4.41e-24	38	233	179	383	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q9XC67	2.04e-20	38	232	251	454	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001106_00612.