CAZyme Information: MGYG000001109_00537

Basic Information

• Species: CAG-110 sp900544975
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900544975
• CAZyme ID: MGYG000001109_00537
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		69275.92	4.5971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001109	2762977	MAG	China	Asia

• Gene Location: Start: 70018; End: 71850 Strand: +

Full Sequence      

MTSKHPMSSKQWLWAFLGTVLLLTILVMGFNFWSDPFGAFGDRFFQWWSYDETMNPRVAK
LSYLEQHHDQYDSYIIGASSSSSFPTDSLNQYFDANFYNLVMYGADMLDVEQTCAYLMKH
YTVKNLVVSVYIHNATVYNTEPDPLTYNLHWKVDGSSPVLFYGKYLLSNPRNGWTKIQRF
YSDPYLQQSYRVFHADTGAYDKSRRDVEPIGDLESYLEKSAYTVFTNYPSGNVGIPHLDD
CMNSISRIRDMCNANDVNLIVVCPPMYHAYMERYSQADQAAFRNALARIVPYWDFTLSSA
SYEPRYFYDETHFRNCLGKMALARIFEDHSIYVPADFGEYVTAPPGTAQVSAPIAAEEYT
TKIPILLYHHLAQEGTGNDTISSSRFEEHLAALQSAGYTTVTFQDLQDYVELGQELPEKP
VLITFDDGYESNYTLAYPLLQKYQMKATIFPIGVSVGKDTYKDTGVDMIPHFTLEQAAEM
EASGLVSMESHGFNIHEVQGRDVEPIRKGILPKEGESEEAYVEFLSQDCQAMTELLGRSP
EVLAYPQGIYSELSEVILSQQGIYATVTIVPKINTIIKGLPQSLRQLGRLYMTETTTAQD
LLSQLSAQDG

Enzyme Prediction     

No EC number prediction in MGYG000001109_00537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	414	566	1.9e-22	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03938	deacetyl_PgaB	5.03e-39	365	601	5	257	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
cd10969	CE4_Ecf1_like_5s	3.39e-33	386	568	4	182	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10966	CE4_yadE_5s	6.58e-33	417	601	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
cd10918	CE4_NodB_like_5s_6s	5.18e-31	420	595	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10964	CE4_PgaB_5s	1.93e-27	416	594	1	192	N-terminal putative catalytic polysaccharide deacetylase domain of bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, and similar proteins. This family is represented by an outer membrane lipoprotein, poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase (PgaB, EC 3.5.1.-), encoded by Escherichia coli pgaB gene from the pgaABCD (formerly ycdSRQP) operon, which affects biofilm development by promoting abiotic surface binding and intercellular adhesion. PgaB catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PGA), a biofilm adhesin polysaccharide that stabilizes biofilms of E. coli and other bacteria. PgaB contains an N-terminal NodB homology domain with a 5-stranded beta/alpha barrel, and a C-terminal carbohydrate binding domain required for PGA N-deacetylation, which may be involved in binding to unmodified poly-beta-1,6-GlcNAc and assisting catalysis by the deacetylase domain. This family also includes several orthologs of PgaB, such as the hemin storage system HmsF protein, encoded by Yersinia pestis hmsF gene from the hmsHFRS operon, which is essential for Y. pestis biofilm formation. Like PgaB, HmsF is an outer membrane protein with an N-terminal NodB homology domain, which is likely involved in the modification of the exopolysaccharide (EPS) component of the biofilm. HmsF also has a conserved but uncharacterized C-terminal domain that is present in other HmsF-like proteins in Gram-negative bacteria. This alignment model corresponds to the N-terminal NodB homology domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS77609.1	3.89e-40	362	602	21	266
ASF40455.1	1.84e-39	354	580	201	431
CCG46444.1	1.84e-39	354	580	201	431
AIS53446.1	1.02e-37	350	606	19	288
ARI76505.1	1.08e-37	361	600	225	467

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WCJ_A	6.09e-17	365	574	39	235	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4U10_A	6.40e-16	365	562	6	225	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]
3VUS_A	2.62e-14	368	496	13	148	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9J_A	1.39e-13	368	496	17	152	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]
4F9D_A	1.83e-13	368	496	17	152	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	1.33e-21	358	571	60	245	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q6G606	1.44e-13	367	563	63	246	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q99QX2	1.44e-13	367	563	63	246	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaB PE=3 SV=1
Q8NUI6	1.44e-13	367	563	63	246	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1
Q7A349	1.44e-13	367	563	63	246	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000001	0.000012	0.000001	0.000000	0.000000	0.000017

TMHMM  Annotations     

start	end
12	34