CAZyme Information: MGYG000001112_00775

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D
• CAZyme ID: MGYG000001112_00775
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
696	MGYG000001112_12|CGC3	79433.18	5.6909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001112	2020645	MAG	China	Asia

• Gene Location: Start: 290402; End: 292492 Strand: +

Full Sequence      

MTSSIKQSAEKLGISLSHYDIDGHLIYASPSSIDYFIEQLQFPPNTGQNQLFQDVICAFE
NEPIQYDLTAFSSPPDASLRYQLLDEQNQIQFEKTIPYSTALSLPALPFGYYCLVIFIAQ
QTFSVQILVSPRTAYQPPLLEQQKAWGVNVQLYSLRSKHNWGIGDFSDLAYLIEKSAEHG
ADFVGINPLHLLYPSVPEWASPYSSSSRRWLNFIYLDVTALPEFKLAKSVQNWVNSADIA
NLIQSLRDQDTVNYSAVTELKLTALEQLFAFSQRSKSAAIIKRREAFAAYQKEQGEALVL
QGLFNVLDKIEHADQQAEENTIGWLGWREEWQHLTAAKRKALIKQYKSEIDFFAWLQWLT
EQQLNDLKHLCQKVGMRLGIYGDLAVNSSRGSVDVWSQPELYCVKASVGAPPDPLGPVGQ
NWNLPPYNPSQLKATGFAAVITMLRANMQHFGILRIDHVMGLFRLWLIPEGKTAADGLYV
HYPFDELMAILAIESQRNQCLIIGEDLGTVPDEVRWKLNEFRIFSYFVLYFAQRNRQYPH
ANEFPRNAYATIGTHDVPSLQSFWHCRDLALFDELNILKGDVLKEKYDQRVIDKQAMIDS
LHRDGYLPPDYHGDALSMAMHDNLNRQIHRYLAHSQSALIGVQLENLIGQEISFNLPGTS
TEYPNWQKKLGQSLELIFNDENLKTFFAQIDQARKA

Enzyme Prediction     

No EC number prediction in MGYG000001112_00775.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	150	692	1.4e-145	0.9898785425101214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00217	malQ	0.0	132	692	1	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1640	MalQ	0.0	134	696	1	518	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK11052	malQ	0.0	1	696	2	691	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	0.0	1	694	4	721	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	9.21e-172	150	670	1	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOR07577.1	0.0	1	696	3	698
QOR05741.1	0.0	1	696	3	698
CBW15651.1	0.0	1	696	3	698
SNV83778.1	0.0	1	696	3	698
QQB09396.1	0.0	1	696	3	697

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	2.53e-168	83	692	79	685	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	1.00e-161	83	692	79	685	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	2.74e-70	107	666	139	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
1TZ7_A	9.87e-28	147	564	25	413	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
2X1I_A	7.70e-23	252	556	95	395	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45176	0.0	1	694	6	697	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P15977	4.10e-169	83	696	79	689	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P65337	7.35e-82	1	685	4	708	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	7.35e-82	1	685	4	708	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	7.35e-82	1	685	4	708	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001112_00775.