CAZyme Information: MGYG000001112_01699

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D
• CAZyme ID: MGYG000001112_01699
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000001112_24|CGC1	43799.31	7.4536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001112	2020645	MAG	China	Asia

• Gene Location: Start: 25268; End: 26437 Strand: -

Full Sequence      

MIKENPTIAIVAGEVSGDILGAGLIQALKRHYPQAKFVGIGGERMIAQGFESFFDMEELS
VMGLVEVLKHLPRLLKIRRSIIEQLSTIKPDVFIGIDAPDFNLTVELKLKEKGIKTIHYV
SPSVWAWRQNRIYKIAKATHQVLAFLPFEKAFYDRFNVPCRFIGHTMADAIPLKPNRMEA
CQTLGIDEKGRYLAILVGSRGSEVGFLTEPFLKTALLLKEKYPDLQFLVPLVNEKRRQQF
EEIKAQIAPDLDMHLIDGKARQVMIAAEATLLASGTAALEAMLCKSPMVVGYRMKPFTHF
LAKRLVKTKYISLPNLLADEMLVPEIIQEDCEPQKLAEQLSQYLGDDESAVKSRSVLIQR
FTELHKLIQCDADSQAAQAVVDLLEQKHD

Enzyme Prediction     

No EC number prediction in MGYG000001112_01699.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	369	2.5e-139	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	383	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	386	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	5	387	1	378	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	3.97e-179	8	380	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	5.80e-47	5	340	226	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI30784.1	7.40e-275	1	389	1	389
QOR25549.1	4.28e-274	1	389	1	389
QOR08915.1	6.08e-274	1	389	1	389
QOR16198.1	4.99e-273	1	389	1	389
QOR23543.1	2.03e-272	1	389	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.48e-162	1	385	1	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.98e-162	1	385	1	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45011	7.88e-223	1	387	1	387	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lpxB PE=3 SV=2
A5UD44	1.12e-222	1	385	1	385	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=lpxB PE=3 SV=1
Q4QLM6	1.30e-221	1	385	1	385	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=lpxB PE=3 SV=1
A5UII8	3.73e-221	1	387	1	387	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=lpxB PE=3 SV=1
Q65VI1	9.75e-214	1	387	8	394	Lipid-A-disaccharide synthase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001112_01699.