CAZyme Information: MGYG000001117_00391

Basic Information

• Species: Phascolarctobacterium_A sp900547415
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A sp900547415
• CAZyme ID: MGYG000001117_00391
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MGYG000001117_17|CGC1	61453.66	9.21

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001117	1799317	MAG	China	Asia

• Gene Location: Start: 22825; End: 24417 Strand: +

Full Sequence      

MSKKYWLFLLLAAVTILFMGNSVLYVTDSVESNYALTAKEMVLSGDWLSPQIYGRYWFDK
PILFYWLTALGFKLFGFNEFGARFFPAVFGFGAICLAAYGGTKLYNERVGWLSGFILLSS
VEFFLISKSIITDAVLFLFFSAALLFFYLGYRENRKSYWYAMYISAGLAVLTKGPIGVLL
PGMIIVLFLLWQRDWQIFKKCHLFRGILLFIVVAFPWYIAMYTIHGSEFINTFFGVHNYL
RATVSEHPRDNVIYYYTLVNILALFPWCLLIPWVLWRRLYEHNYHIQAREGFLLIWIGAI
FFFFQSMATKYITYTYPLLFPAAIILGHILDKYGDKCLYKGFNQLFVAFLTMLVGSAWWC
NVQGILPVQELYLLPAGLLVGILLYYAFQYMQVKKFIGVGCICLCFYLSLIYAVAVPLTE
YRSGKELGLTLKLNNVAEVGAYGSYPTSAVFYSDAKIYKLLKRNDIDSYRPHAMSWSSKN
VMPYAVMEEANFDRVAVKYKNLRDFYRAEGAMWQPVGYCKEWILLEHKKL

Enzyme Prediction     

No EC number prediction in MGYG000001117_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	460	4e-105	0.8777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.64e-50	3	330	6	336	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.68e-32	1	341	2	340	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	8.51e-22	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.07e-16	7	225	5	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	4.95e-05	63	173	68	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	2.21e-211	1	529	1	528
ADB46704.1	4.55e-143	1	484	1	494
AEQ23377.1	2.26e-140	1	528	1	545
AJQ28749.1	1.93e-113	21	483	32	497
BBK25530.1	1.23e-111	2	530	7	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.90e-35	6	336	33	370	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	7.11e-31	1	462	1	444	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q02R27	7.25e-26	1	357	1	360	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
Q4K884	1.16e-25	31	357	65	389	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q3KCB9	1.76e-25	1	353	1	359	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT2 PE=3 SV=1
O67601	1.82e-25	1	339	1	316	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999994	0.000022	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
5	27
80	102
109	126
130	149
170	192
202	224
254	276
286	304
311	330
345	362
369	391
396	418