CAZyme Information: MGYG000001120_01228

Basic Information

• Species: Butyricicoccus_A sp002395695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Butyricicoccus_A; Butyricicoccus_A sp002395695
• CAZyme ID: MGYG000001120_01228
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000001120_26|CGC1	51661.28	8.4927

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001120	2280051	MAG	China	Asia

• Gene Location: Start: 14451; End: 15827 Strand: +

Full Sequence      

MDNRKILRAASALLCTSVLVSASALALDKQAYAAAQNDAQISVSDAAQYSVGLQKSDIQR
KRSVPVLMYHLISDDIWGSREMFTSPSVFRQQLQYLKDHGYQTITFEDLDHLERYPKPVL
LTFDDGYADNYTTVYPMLKEFGMKATFFVVPNNLDRQHNMTREQIKELSDSGVVSIQSHS
LTHANMTKLSDSQQEYEMKESQRQLRELTGKSPIALTYPEGGYTKTTLSLTARYYHFGIC
AGGNRWKISDDFYTIPRYRMHRSTTMAQFEDYVDQSVSRIFTDVSASKWSTPYIEQVYSA
NYMRGTSGDTFQPTKTLTRAESVQVLYALAGKPAVSGQTPFHDVASGAWYQQAVTWAYQT
RITSGVLPNEFRPNDPISREQLIVMLYRYSGSPAVSDLLHKKHYADAKQVSDWARPAMNW
AIANGVISGIPSGHKVLLSPHTNSTREQVATIIAKTFC

Enzyme Prediction     

No EC number prediction in MGYG000001120_01228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	115	231	1.2e-31	0.8461538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	3.28e-50	118	263	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	1.35e-42	86	258	1	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10970	CE4_DAC_u1_6s	2.52e-34	119	275	3	160	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	1.08e-33	116	234	6	119	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
COG0726	CDA1	4.98e-29	65	234	2	178	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIS53446.1	4.55e-44	50	455	20	473
QZY32711.1	2.48e-32	64	273	65	275
QYR62058.1	3.16e-31	61	282	10	249
ARE59829.1	2.06e-30	210	453	720	957
QQR06511.1	2.06e-30	210	453	720	957

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V33_A	4.20e-39	50	269	130	355	Crystalstructure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis],4V33_B Crystal structure of the putative polysaccharide deacetylase BA0330 from bacillus anthracis [Bacillus anthracis]
4HD5_A	2.87e-36	50	269	130	355	CrystalStructure of BC0361, a polysaccharide deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
6GO1_A	1.07e-32	53	269	89	313	CrystalStructure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis],6GO1_B Crystal Structure of a Bacillus anthracis peptidoglycan deacetylase [Bacillus anthracis]
6DQ3_A	5.02e-25	64	239	9	194	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4U10_A	5.59e-12	66	180	6	145	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94361	1.26e-31	59	274	60	276	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
P19424	5.93e-19	281	454	41	211	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
P38537	1.12e-16	287	456	40	205	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1
P38536	1.26e-16	269	453	1670	1851	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	2.37e-14	281	453	908	1077	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000643	0.998208	0.000417	0.000280	0.000231	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001120_01228.