CAZyme Information: MGYG000001123_00322

Basic Information

• Species: Collinsella sp900757265
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900757265
• CAZyme ID: MGYG000001123_00322
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219	MGYG000001123_74|CGC1	25314.42	4.7453

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001123	1615884	MAG	China	Asia

• Gene Location: Start: 2132; End: 2791 Strand: -

Full Sequence      

MTSGINNRWWLDLITKGELPADVLDSLAEGGVKLPFRAGDQEILKQGVVDWLGCNYYHPT
RVQAPASKVDQYGLPHFADEYVWPDAVMNESRGWEIYPQGLYDFGMDCAKNYPDLEWFVS
ENGIGIMDEYKNRDAEGTIQDDYRVDFVRQHLEWVAKAIDEGAKCRGYHYWAVIDNWSWA
NAFKNRYGFVEVDLMDGYKRRLKKSAAWLKQVATTHVVD

Enzyme Prediction     

No EC number prediction in MGYG000001123_00322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	215	9.4e-53	0.4289044289044289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	1.75e-73	5	215	247	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.98e-52	4	216	243	451	Glycosyl hydrolase family 1.
PRK13511	PRK13511	1.34e-40	5	219	241	469	6-phospho-beta-galactosidase; Provisional
PRK09852	PRK09852	1.06e-20	7	219	262	472	cryptic 6-phospho-beta-glucosidase; Provisional
PLN02814	PLN02814	8.81e-12	9	208	282	475	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54210.1	1.81e-167	1	219	248	466
AZH70290.1	2.56e-167	1	219	248	466
BCV18986.1	5.08e-126	1	219	249	467
ACV50514.1	1.45e-122	1	219	247	465
QUC04859.1	2.31e-118	1	219	233	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	2.26e-54	6	214	247	457	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	3.23e-54	6	214	248	458	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAQ_A	2.01e-50	6	212	263	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAV_A	3.95e-50	6	212	263	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	1.83e-35	7	219	252	451	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	7.10e-65	7	213	251	460	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
C1CEE7	1.57e-34	5	219	241	468	6-phospho-beta-galactosidase OS=Streptococcus pneumoniae (strain JJA) OX=488222 GN=lacG PE=3 SV=1
Q8DPP6	4.19e-34	5	219	241	468	6-phospho-beta-galactosidase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lacG2 PE=3 SV=1
Q8E4S2	5.83e-34	5	219	241	468	6-phospho-beta-galactosidase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=lacG PE=3 SV=1
Q97QL9	5.83e-34	5	219	241	468	6-phospho-beta-galactosidase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lacG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001123_00322.