CAZyme Information: MGYG000001129_00394

Basic Information

• Species: Ruminococcus_C sp000437255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000437255
• CAZyme ID: MGYG000001129_00394
• CAZy Family: CBM79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		41717.45	4.1894

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001129	1878365	MAG	China	Asia

• Gene Location: Start: 5101; End: 6270 Strand: -

Full Sequence      

MKAKEFLAAAAAVMIAAVGSGSVLMSLTAMDTEAASTSKPATLTTNSKGTTCFRTEGADR
LVVEVSGVAGASCSGLVGWYTDEWHEVKWDTNGLNSSGTGTFTVDLSGVPEDKDIELQTN
YYAKWDNSKQEMVNISGTPTFTSVTLYFGSDDGTTTTPAVTAPVVDPTWSAHSITPGKEY
DYSTMPDDDKMIGWKWSEFGLQEGELVKRVDVKISVPSGTIGKWSGGFGSSTTVKPDYWT
MEEMEDTYNTQSAIISWTVPAATAKTFQTQGNYSYLKFGTFYTTNGSVFSVDSVTVYTDP
STIVTTTTTAATTTTTTTTTTVDPSKAMIGDVTQNGKVNLSDVVMLQKYLMDSYDLSDAQ
MKLADVTEDGNVTADDVTALMKSLLKITK

Enzyme Prediction     

No EC number prediction in MGYG000001129_00394.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM79	184	295	1.6e-33	0.9818181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18522	DUF5620	1.04e-24	186	297	1	119	Domain of unknown function (DUF5620). This is a domain of unknown function predicted to be a carbohydrate binding module.
cd14256	Dockerin_I	4.12e-16	329	385	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
pfam00404	Dockerin_1	1.49e-11	330	385	1	56	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.
cd14252	Dockerin_like	6.72e-07	335	385	6	57	Dockerin repeat domains and domains resembling dockerin repeats. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.
cd14253	Dockerin	1.05e-06	330	385	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDE32079.1	3.14e-244	1	389	1	389
CDF00679.1	2.95e-32	137	302	95	271
ERJ89368.1	1.05e-26	182	360	82	278
EWM53237.1	2.11e-20	188	350	658	828
CDE12955.1	5.06e-15	191	303	246	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4V1L_A	1.23e-14	172	296	6	129	Highresolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V1L_B High resolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1],4V1L_C High resolution structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1]
4D3L_A	5.29e-13	172	296	6	129	SeMetstructure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4D3L_B SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4D3L_C SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 in the orthorhombic form [Ruminococcus flavefaciens FD-1],4V1K_A SeMet structure of a novel carbohydrate binding module from glycoside hydrolase family 9 (Cel9A) from Ruminococcus flavefaciens FD-1 [Ruminococcus flavefaciens FD-1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007117	0.991685	0.000272	0.000440	0.000236	0.000215

TMHMM  Annotations     

start	end
7	29