CAZyme Information: MGYG000001131_00682

Basic Information

• Species: Prevotella sp900543585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543585
• CAZyme ID: MGYG000001131_00682
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000001131_28|CGC1	35422.43	9.9664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001131	3153631	MAG	China	Asia

• Gene Location: Start: 34187; End: 35113 Strand: +

Full Sequence      

MHSIKYSILIILSLAITVGARAQMRINTAYQQYISQYKDLAIEQMVRYHIPASITLAQGL
FESRAGLSRLASVGNNHFGIKCHGWKGRSINADDDAPGECFRAYDNAKQSYEDHSRFLRN
SPRYASLFNLRITDYKGWARGLKACGYATNPRYADNLINIVELYGLSKYDKAKDYDHFMA
DRYDARNHSYAPNGFHPISRCNKNYYIIARDGDTFRSLSKETGISRRKLAKYNERDKDDV
LHNGDIIYLKKKQKKAMKVFKNKPHVVKDGESMYSIAQMYGIRLKNLYEMNHMAPEDGIS
VGQLLKVR

Enzyme Prediction     

No EC number prediction in MGYG000001131_00682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	39	166	2.4e-31	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	8.47e-34	31	170	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	3.33e-33	31	175	44	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.25e-24	23	176	1	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	3.01e-22	38	114	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK06347	PRK06347	4.78e-20	15	307	143	449	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29226.1	1.34e-137	1	307	1	307
VEH15664.1	2.47e-130	5	307	3	305
QNT66218.1	2.96e-129	22	308	21	307
ALO49150.1	3.02e-126	10	307	7	304
BCS86660.1	2.75e-125	22	307	2	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	8.90e-12	50	161	21	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.06e-11	50	161	22	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	6.96e-11	50	161	22	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.90e-14	47	171	65	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	3.48e-11	52	308	202	473	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	2.28e-10	31	160	161	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	2.30e-07	33	160	164	302	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P39046	2.68e-07	25	170	59	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000258	0.999102	0.000176	0.000155	0.000146	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001131_00682.