CAZyme Information: MGYG000001131_00787

Basic Information

• Species: Prevotella sp900543585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543585
• CAZyme ID: MGYG000001131_00787
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		43209.93	8.5732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001131	3153631	MAG	China	Asia

• Gene Location: Start: 163324; End: 164430 Strand: +

Full Sequence      

MNTLCLITNIAPHYRRPIFEQIDKEIGCDFYIGDHIESELKIFDYYVLSGYRRTVHNIFF
HHWYWQKNTVGLIFKSYKYYILDGEPYCLSSWAILLLAKLLGKQTIAWTHGWYGRERGMK
KHVKKVFYALFSKLMLYNEYAIDLMVKEGFDRNKIYCIANSLDSDKELTIRKQLRPSDIY
QLHFGNAYPTIIYCGRIQKRKKIEQIFESLNILRSQGDIVNLVIVGKDVDGASLANDIRR
LKLEKQIWMYGPCYDDYQLGELFYNATVCVSPGNVGLSAIHSLTFGCPVITHDHFPDQMP
EFEAIQPNVTGDFFKQNDVKDLARVIKIWIERSRDNKSAIQQAAFKEIDRKWNIHYQIKT
MKEVMNAD

Enzyme Prediction     

No EC number prediction in MGYG000001131_00787.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	188	335	6.8e-17	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00534	Glycos_transf_1	7.77e-18	189	343	3	155	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
COG0438	RfaB	3.50e-17	10	367	17	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	1.21e-16	4	362	2	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03819	GT4_WavL-like	2.87e-14	90	345	87	333	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
cd03801	GT4_PimA-like	1.05e-12	89	364	92	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB27736.1	7.13e-180	2	365	5	368
QUI93286.1	3.20e-166	2	368	3	369
AUI56186.1	4.07e-162	2	366	5	369
QCQ51765.1	2.23e-157	2	366	6	371
QKH84776.1	2.23e-157	2	366	6	371

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999995	0.000033	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001131_00787.