CAZyme Information: MGYG000001131_02123

Basic Information

• Species: Prevotella sp900543585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900543585
• CAZyme ID: MGYG000001131_02123
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000001131_89|CGC1	54748.49	4.8696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001131	3153631	MAG	China	Asia

• Gene Location: Start: 20811; End: 22262 Strand: +

Full Sequence      

MKKYILAGVALCTLLLGCSNSNDWDVTSDLRVDKEDPTVGLTPLAETEGEDYAPLYWSVY
GSLRQQEKEGSFPNIFTEADWDKAIDYVATNLKPYGYDMLVTDGFASMSGDDGYMTRYSR
TEKNENSPEVELSTIVAKLKAKGLKLGVYDSPFWLHYTNPNAIIPGTDGITVGSLRYNPA
IDTDVLHPTKDDHFWWVVTSHPGAEEYFEGFFKHYADLGVKFIRMDFLSWYEDGMNYNDQ
IDKGYGRERYVKGMQWINKYAKKYGIYVSLVMPHLKNDAIIEKYAGNMIRIDADALEGSW
YRFSDNNRGTLRGGWPNSENAFDGFINWSKISGRKKVRLDGDFIRIGSYANDDEKMSVVS
LPLLAGGPIAVTDYPSAEDLKFFQNSELLALQKDGFVGQPLARTFYGTDGEIWYGQMKDG
SWIIGFFNREQSAETRSLDLSRIGLSGTYKVRDLWKHEDEGSVTDRLEYNVPAHGCKIVK
LTK

Enzyme Prediction     

No EC number prediction in MGYG000001131_02123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	202	460	1.8e-29	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	3.39e-16	411	481	5	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
PLN02808	PLN02808	6.04e-10	227	482	142	384	alpha-galactosidase
PLN02229	PLN02229	1.56e-08	227	482	172	418	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB63374.1	9.58e-307	1	483	1	482
QUB55922.1	1.36e-306	1	483	1	482
QUB58522.1	1.36e-306	1	483	1	482
ADK96222.1	1.93e-306	1	483	1	482
ASE17782.1	1.93e-306	1	483	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	1.16e-73	54	482	38	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]
4NX0_A	4.18e-13	57	482	32	441	Crystalstructure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_B Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_C Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_D Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_E Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_F Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_G Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_H Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3A5V_A	3.70e-06	340	480	238	389	Crystalstructure of alpha-galactosidase I from Mortierella vinacea [Umbelopsis vinacea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	1.16e-73	54	482	64	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000065	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001131_02123.